-
HPA053361-100ULImmunogen phospholipase A2, group V Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
-
HPA001171-100ULPLA2G6 (phospholipase A2, group VI) localizes in the mitochondria. Immunogen 85 kDa calcium-independent phospholipase A2 recombinant protein epitope signature tag (PrEST) Application Anti-PLA2G6 antibody produced in rabbit, a Prestige Antibody, is
-
HPA053665-100ULImmunogen Recombinant protein corresponding to phospholipase C delta 3 Sequence EGHQSEGLRRFGGAFAPARCLTIAFKGRRKNLDLAAPTAEEAQRWVRGLTKLRARLDAMSQRERLDHWIHSYLHRADSNQDSKMSFKEIKSLLRMVNVDMNDMYAYLLFK Application All Prestige Antibodies Powered by Atlas
-
HPA038139-100UL
Sigma-Aldrich
Anti-PLCD4 antibody produced in rabbit (C15-1455-087)
Price: $928.29List Price: $1,031.43Immunogen phospholipase C, delta 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA038140-100UL
Sigma-Aldrich
Anti-PLCD4 antibody produced in rabbit (C15-1455-088)
Price: $928.29List Price: $1,031.43Immunogen phospholipase C, delta 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA072705-100ULImmunogen Recombinant protein corresponding to phospholipase C eta 2 Sequence AEEDVESGEDAGASRRNGRLVVGSFSRRKKKGSKLKKAASVEEGDEGQDSPGGQSRGATRQKKTMKLSR Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the
-
HPA031849-100ULImmunogen phospholipase C-like 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported
-
HPA007721-100ULImmunogen phosphatidylinositol-specific phospholipase C, X domain containing 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas
-
HPA055947-100ULImmunogen phosphatidylinositol-specific phospholipase C, X domain containing 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas
-
HPA046849-100ULImmunogen phosphatidylinositol-specific phospholipase C, X domain containing 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas
-
AV44768-100UL
Sigma-Aldrich
Anti-PLD3 antibody produced in rabbit (C15-1341-517)
Price: $898.29List Price: $998.10Immunogen Synthetic peptide directed towards the N terminal region of human PLD3 Application Anti-PLD3 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/ml. -
HPA012800-100UL
Sigma-Aldrich
Anti-PLD3 antibody produced in rabbit (C15-1447-862)
Price: $977.14List Price: $1,085.71Phospholipase D3 (PLD3) is a ubiquitously expressed type 2 transmembrane protein. It is present in the endoplasmic reticulum.