-
HPA053367-100ULImmunogen Recombinant protein corresponding to protein tyrosine phosphatase, non-receptor type 18 Sequence EEAPLYSKVTPRAQRPGAHAEDARGTLPGRVPADQSPAGSGAYEDVAGGAQTGGLGFNLRIGRPK Application All Prestige Antibodies Powered by Atlas Antibodies are
-
HPA001466-100ULPTPN6 (protein tyrosine phosphatase, non-receptor type 6) is a 68kDa cytoplasmic protein that is predominantly expressed in hematopoietic cell development, proliferation and receptor-mediated mitogenic signaling pathways. The gene contains 17 exons
-
HPA021223-100ULPTRH1 (peptidyl-tRNA hydrolase) is responsible for release of tRNA from peptidyl-tRNA by breaking the ester bong between the peptide and the tRNA. Immunogen Probable peptidyl-tRNA hydrolase recombinant protein epitope signature tag (PrEST)
-
HPA012897-100ULPeptidyl-tRNA hydrolase 2 (PTRH2) is primarily a mitochondrial protein and is mainly expressed in the developing brain. It contains an amino-terminal signaling sequence which is involved in its mitochondrial localization.
-
HPA038327-100UL
Sigma-Aldrich
Anti-R3HDM2 antibody produced in rabbit (C15-1455-192)
Price: $928.29List Price: $1,031.43Immunogen R3H domain containing 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA038328-100UL
Sigma-Aldrich
Anti-R3HDM2 antibody produced in rabbit (C15-1455-193)
Price: $928.29List Price: $1,031.43Immunogen R3H domain containing 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA025928-100ULImmunogen Ras-related protein Rab-18 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
-
HPA042505-100ULRas-related protein RAB39A, a member RAS oncogene family is mainly localized on late endosomes and lysosomes. It is encoded by the gene mapped to human chromosome 11q22.
-
HPA001114-100ULImmunogen Ras-related protein Rab-39B recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
-
HPA039723-100ULImmunogen RAB3A interacting protein (rabin3)-like 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a
-
HPA059131-100ULImmunogen RAB6A, member RAS oncogene family Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization
-
A3937-.25ML
Sigma-Aldrich
Anti-Rabbit IgG (whole molecule), F(ab')2 fragment-Alkaline Phosphatase antibody produced in goat (C15-1315-146)
Price: $285.00List Price: $316.67IgGs are glycoprotein antibodies that modulate several immune responses. Rabbit IgGs against target proteins are often used as primary antibodies in various research applications.