-
HPA038912-100UL
Sigma-Aldrich
Anti-RBMXL2 antibody produced in rabbit (C15-1455-503)
Price: $928.29List Price: $1,031.43Immunogen RNA binding motif protein, X-linked-like 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA051842-100UL
Sigma-Aldrich
Anti-RBMXL2 antibody produced in rabbit (C15-1460-814)
Price: $928.29List Price: $1,031.43Immunogen RNA binding motif protein, X-linked-like 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA041301-100UL
Sigma-Aldrich
Anti-RBP3 antibody produced in rabbit (C15-1456-617)
Price: $928.29List Price: $1,031.43Immunogen retinol binding protein 3, interstitial Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA044239-100UL
Sigma-Aldrich
Anti-RBP3 antibody produced in rabbit (C15-1458-080)
Price: $928.29List Price: $1,031.43Immunogen retinol binding protein 3, interstitial Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
AV31121-100UL
Sigma-Aldrich
Anti-RBPJ antibody produced in rabbit (C15-1340-621)
Price: $898.29List Price: $998.10RBPJ is a transcriptional repressor that targets notch signaling. Studies have reported that it can activate the K14/vGPCR promoter of Kaposi′s sarcoma-associated herpesvirus (KSHV). -
HPA060647-100UL
Sigma-Aldrich
Anti-RBPJ antibody produced in rabbit (C15-1463-597)
Price: $928.29List Price: $1,031.43Immunogen recombination signal binding protein for immunoglobulin kappa J region Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
HPA067971-100ULImmunogen retinal degeneration 3-like Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
-
HPA049199-100ULImmunogen retinol dehydrogenase 10 (all-trans) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive
-
HPA000263-100UL
Sigma-Aldrich
Anti-RDX antibody produced in rabbit (C15-1444-901)
Price: $879.43List Price: $977.14Immunogen Radixin recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA000763-100UL
Sigma-Aldrich
Anti-RDX antibody produced in rabbit (C15-1445-045)
Price: $879.43List Price: $977.14Immunogen Radixin recombinant protein epitope signature tag (PrEST) Sequence AAEEAKSAIAKQAADQMKNQEQLAAELAEFTAKIALLEEAKKKKEEEATEWQHKAFAAQEDLEKTKEELKTVMSAPPPPPPPPVIPPTENEHDEHDENNAEASAELSNEGVMNHRSE Application All Prestige Antibodies Powered by Atlas -
HPA071729-100ULImmunogen reversion-inducing-cysteine-rich protein with kazal motifs Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most
-
HPA030960-100UL
Sigma-Aldrich
Anti-RECQL antibody produced in rabbit (C15-1452-913)
Price: $879.43List Price: $977.14Immunogen RecQ helicase-like Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.