Cell Culture Reagents

Immunogen RERG/RAS-like recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

RESP18 (regulated secretory protein) is an endocrine secretory protein transcript. It is of 18kDa with around 800 nucleotides in length.

Proto-oncogene tyrosine-protein kinase receptor Ret (RET) is a receptor for the glial derived neurotrophic factor (GDNF) family of ligands. RET gene codes for the RET receptor protein.

Immunogen resistin like beta recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen all-trans-Retinol 13,14-reductase precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen retinol saturase (all-trans-retinol 13,14-reductase) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Ring finger and FYVE-like domain containing E3 ubiquitin protein ligase (RFFL) contains a zinc finger domain, a pocket for phosphoinositide binding and a loop which helps in membrane insertion. RFFL is localized to endocytic vesicles.

RFFL (Ring finger and FYVE-like domain containing E3 ubiquitin protein ligase) is a caspase-associated ring protein belonging to a family of protein ubiquitin ligases. It consists of a specialized FYVE-type zinc finger domain, a cramped

Immunogen ral guanine nucleotide dissociation stimulator-like 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project

Immunogen ral guanine nucleotide dissociation stimulator-like 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project

Immunogen Synthetic peptide directed towards the N terminal region of human RGS18 Biochem/physiol Actions RGS18 is a member of the regulator of G-protein signaling family. This protein is contains a conserved, 120 amino acid motif called the RGS

Immunogen Recombinant protein corresponding to regulator of G-protein signaling 18. Sequence FHTKEVITNSITQPTLHSFDAAQSRVYQLMEQDSYTRFLKSDIYLDLMEGRPQRPTNLRRRSRSFTCNEFQDVQSDVAIW Application All Prestige Antibodies Powered by Atlas Antibodies are