-
Add to Cart The item has been addedHPA035558-100ULSigma-Aldrich
Anti-RNF186 antibody produced in rabbit (C15-1453-912)
Price: $928.29List Price: $1,031.43Immunogen ring finger protein 186 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA049587-100ULSigma-Aldrich
Anti-RNF19B antibody produced in rabbit (C15-1460-009)
Price: $928.29List Price: $1,031.43Immunogen ring finger protein 19B recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedHPA063640-100ULSigma-Aldrich
ANTI-RNF19B ANTIBODY PRODUCED IN RABBIT (C15-1464-428)
Price: $977.14List Price: $1,085.71Immunogen ring finger protein 19B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA051773-100ULImmunogen ring finger protein 20, E3 ubiquitin protein ligase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA021256-100ULSigma-Aldrich
Anti-RNF208 antibody produced in rabbit (C15-1449-809)
Price: $879.43List Price: $977.14Immunogen RING finger protein 208 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedHPA021429-100ULSigma-Aldrich
Anti-RNF208 antibody produced in rabbit (C15-1449-861)
Price: $879.43List Price: $977.14Immunogen RING finger protein 208 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedHPA057527-100ULImmunogen ring finger protein 212 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA003347-100ULSigma-Aldrich
Anti-RNF213 antibody produced in rabbit (C15-1445-906)
Price: $977.14List Price: $1,085.71Immunogen Protein ALO17 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the -
Add to Cart The item has been addedHPA026790-100ULSigma-Aldrich
Anti-RNF213 antibody produced in rabbit (C15-1451-204)
Price: $879.43List Price: $977.14The ring finger protein 213 (RNF213) gene is mapped around 137,922-bp region on chromosome 17q25.3. -
Add to Cart The item has been addedHPA039332-100ULImmunogen ring finger protein 214 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedHPA029427-100ULSigma-Aldrich
Anti-RNF215 antibody produced in rabbit (C15-1452-262)
Price: $879.43List Price: $977.14Immunogen Recombinant protein corresponding to ring finger protein 215 Sequence LPLLVQFPAMGNSYGAMTCLTRWLRRGQKGLDDVSRAANCTSSCQLCKWICPSALGVWRGWENPGHLISNPVPRWVPSTPMPWGPGQWAAGGCVLGTSPMVWFGDPFQEPRRGTHRSRARISM Application All Prestige Antibodies Powered -
Add to Cart The item has been addedHPA056498-100ULSigma-Aldrich
Anti-RNF215 antibody produced in rabbit (C15-1462-368)
Price: $928.29List Price: $1,031.43Immunogen ring finger protein 215 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
