-
HPA045288-100ULImmunogen WAS protein family, member 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
-
HPA066228-100ULImmunogen WAS protein family member 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
-
HPA037635-100UL
Sigma-Aldrich
Anti-WBP1L antibody produced in rabbit (C15-1454-819)
Price: $928.29List Price: $1,031.43Immunogen Outcome predictor in acute leukemia 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA038371-100UL
Sigma-Aldrich
Anti-WBP1L antibody produced in rabbit (C15-1455-212)
Price: $928.29List Price: $1,031.43Immunogen WW domain binding protein 1-like Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
HPA050603-100ULImmunogen WD repeat and FYVE domain containing 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,
-
HPA043255-100UL
Sigma-Aldrich
Anti-WDR62 antibody produced in rabbit (C15-1457-600)
Price: $928.29List Price: $1,031.43Immunogen WD repeat domain 62 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
HPA043639-100UL
Sigma-Aldrich
Anti-WDR62 antibody produced in rabbit (C15-1457-799)
Price: $928.29List Price: $1,031.43Immunogen WD repeat domain 62 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
HPA038526-100ULImmunogen WD repeat domain 63 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
-
HPA070759-100ULImmunogen Recombinant protein corresponding to Wnt family member 6 Sequence WEWGGCGDDVDFGDEKSRLFMDARHKRGRGDIRALVQLHNNE Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)
-
HPA052507-100UL
Sigma-Aldrich
Anti-XAGE2 antibody produced in rabbit (C15-1461-042)
Price: $928.29List Price: $1,031.43Immunogen X antigen family, member 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA060900-100UL
Sigma-Aldrich
Anti-XAGE2 antibody produced in rabbit (C15-1463-645)
Price: $928.29List Price: $1,031.43Immunogen X antigen family, member 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA059045-100ULImmunogen X antigen family, member 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the