-
HPA039493-100UL
Sigma-Aldrich
Anti-C11orf57 antibody produced in rabbit (C15-1455-769)
Price: $928.29List Price: $1,031.43Immunogen chromosome 11 open reading frame 57 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA039892-100UL
Sigma-Aldrich
Anti-C11orf57 antibody produced in rabbit (C15-1455-947)
Price: $928.29List Price: $1,031.43Immunogen chromosome 11 open reading frame 57 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA040344-100UL
Sigma-Aldrich
Anti-C11orf63 antibody produced in rabbit (C15-1456-149)
Price: $928.29List Price: $1,031.43Immunogen chromosome 11 open reading frame 63 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA077748-100UL
Sigma-Aldrich
Anti-C11orf63 antibody produced in rabbit (C15-1467-083)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to chromosome 11 open reading frame 63 Sequence ELSDSDLEEKSSSLSPYVKSSSSHNEVFLPGSRGPRRRKSKQHFVEKNKLTLGLPTPKTDSYLQLHNKKRGESHPEQ Application All Prestige Antibodies Powered by Atlas Antibodies are developed -
HPA045938-100ULImmunogen chromosome 11 open reading frame 68 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,
-
HPA038932-100UL
Sigma-Aldrich
Anti-C11orf80 antibody produced in rabbit (C15-1455-511)
Price: $928.29List Price: $1,031.43Immunogen chromosome 11 open reading frame 80 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA038933-100UL
Sigma-Aldrich
Anti-C11orf80 antibody produced in rabbit (C15-1455-512)
Price: $928.29List Price: $1,031.43Immunogen Putative uncharacterized protein C11orf80 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA039663-100ULImmunogen chromosome 12 open reading frame 29 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,
-
HPA038722-100ULImmunogen Uncharacterized protein C12orf45 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
-
HPA073090-100ULImmunogen chromosome 12 open reading frame 54 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization
-
HPA056986-100ULImmunogen chromosome 12 open reading frame 56 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,
-
HPA046182-100UL
Sigma-Aldrich
Anti-C12orf57 antibody produced in rabbit (C15-1458-762)
Price: $928.29List Price: $1,031.43Immunogen chromosome 12 open reading frame 57 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization