-
Add to Cart The item has been addedHPA024828-100ULSigma-Aldrich
Anti-XKR6 antibody produced in rabbit (C15-1450-903)
Price: $879.43List Price: $977.14The gene XKR6 (XK related 6) is mapped to human chromosome 8p23.1. -
Add to Cart The item has been addedHPA064769-100ULSigma-Aldrich
Anti-XKR6 antibody produced in rabbit (C15-1464-724)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to XK related 6 Sequence FVDRRLRRTINILQYVTPTAVGIRYRDGPLLYELLQYESSL Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and -
Add to Cart The item has been addedHPA053768-100ULImmunogen exportin 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
Add to Cart The item has been addedHPA038246-100ULImmunogen exportin 6 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA030063-100ULSigma-Aldrich
Anti-YTHDF2 antibody produced in rabbit (C15-1452-513)
Price: $879.43List Price: $977.14Immunogen Recombinant protein corresponding to YTH N6-methyladenosine RNA binding protein 2 Sequence TQPLPPPPPQPAQLSVQQQAAQPTRWVAPRNRGSGFGHNGVDGNGVGQSQAGSGSTPSEPHPVLEKLRSIN Application All Prestige Antibodies Powered by Atlas Antibodies are -
Add to Cart The item has been addedHPA054080-100ULSigma-Aldrich
Anti-YTHDF2 antibody produced in rabbit (C15-1461-558)
Price: $928.29List Price: $1,031.43Immunogen YTH N(6)-methyladenosine RNA binding protein 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA059621-100ULSigma-Aldrich
Anti-YTHDF2 antibody produced in rabbit (C15-1463-331)
Price: $928.29List Price: $1,031.43YTHDF2 (YTH domain family 2) is also known as an YTH N 6 -methyladenosine(m 6 A) RNA binding protein 2. YTHDF2 gene Is located on human chromosome 1p35. -
Add to Cart The item has been addedHPA007151-100ULImmunogen Zinc finger C3H1 domain-containing protein recombinant protein epitope signature tag (PrEST) Sequence PSRKQNYSSKNENCVEETFEDLLLKYKQIQLELECINKDEKLALSSKEENVQEDPKTLNFEDQTSTDNVSITKDSSKEVAPEEKTQVKTFQAFELKPLRQKLTLPGDKNRLKKVKDGAKPLSL Application -
Add to Cart The item has been addedHPA063338-100ULImmunogen zinc finger protein 441 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA045738-100ULImmunogen zinc finger protein 442 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedHPA056895-100ULSigma-Aldrich
Anti-ZNF444 antibody produced in rabbit (C15-1462-486)
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein 444 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA065203-100ULSigma-Aldrich
Anti-ZNF444 antibody produced in rabbit (C15-1464-826)
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein 444 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
