Cell Culture Reagents

Immunogen Recombinant protein corresponding to zinc finger protein 536 Sequence AFCNFPSDFYKQFGVYPGMVGSGASSSCPNKEPDGKAHSEEDVPILIPETTSKNTTDDLSDIASSEDMDSSKGENNDEEDVETEPEMMTKPL Application All Prestige Antibodies Powered by Atlas Antibodies are

Cell Line Origin Human plasma cell leukaemia Cell Line Description Derived from a 33 year old female with plasma cell leukaemia. The cells synthesise IgG1 (kappa-light chain) and are EBNA positive.

Application Asialofetuin from fetal calf serum is suitable for use: in the assay of the lactose binding activity of the galectin-7 by immunodetection of in situ binding activity to asialofetuin immobilized on nitrocellulose in the inhibition of

Asialofetuin is a glycoprotein with three asparagine-linked triantennary complex carbohydrate chains and terminal N -acetylgalactosamine residues. Application Asialofetuin from fetal calf serum has been used: to quantitate the plant Ricin

Asialofetuin is a glycoprotein with three asparagine-linked triantennary complex carbohydrate chains and terminal N -acetylgalactosamine residues. Application Asialofetuin from fetal calf serum has been used: to quantitate the plant Ricin

Asialofetuin is a glycoprotein with three asparagine-linked triantennary complex carbohydrate chains and terminal N -acetylgalactosamine residues. Application Asialofetuin from fetal calf serum has been used: to quantitate the plant Ricin

Amino Acid Sequence Cer-Glc-Gal-GalNAc-Gal General description Gangliosides are major constituents of neuronal cell membranes and endoplasmic reticulum contain a sialylated polysaccharide chain linked to ceramide through a &#946-glycosidic

Amino Acid Sequence Cer-Glc-Gal-GalNAc-Gal General description Gangliosides are major constituents of neuronal cell membranes and endoplasmic reticulum contain a sialylated polysaccharide chain linked to ceramide through a &#946-glycosidic

AUTO WATER HEATED 6 CELL CHNGR

Nerve Growth Factor (&#946-NGF) is a well characterized neurotropic protein that plays a critical role in the development of sympathetic and some sensory neurons in the peripheral nervous system. In addition, NGF can also act in the central

BL21 host strain is the most widely used host background and has the advantage of being deficient in both lon and ompT proteases. BL21 is the most widely used host background and has the advantage of being deficient in both lon (1) and ompT

BL21 host strain is the most widely used host background and has the advantage of being deficient in both lon and ompT proteases. BL21 is the most widely used host background and has the advantage of being deficient in both lon (1) and ompT