-
Add to Cart The item has been addedHPA012105-100ULImmunogen Uncharacterized protein C3orf18 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA039584-100ULImmunogen chromosome 3 open reading frame 20 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA007678-100ULSigma-Aldrich
ANTI-C3ORF52 ANTIBODY PRODUCED IN RABBIT (C15-1446-957)
Price: $977.14List Price: $1,085.71Immunogen chromosome 3 open reading frame 52 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA008119-100ULSigma-Aldrich
Anti-C3orf52 antibody produced in rabbit (C15-1447-055)
Price: $879.43List Price: $977.14Immunogen TPA-induced transmembrane protein recombinant protein epitope signature tag (PrEST) Sequence AQPSQPVDELELSVLERQPEENTPLNGADKVFPSLDEEVPPAEANKESPWSSCNKNVVGRCK Application All Prestige Antibodies Powered by Atlas Antibodies are developed and -
Add to Cart The item has been addedHPA011968-100ULSigma-Aldrich
Anti-C3orf52 antibody produced in rabbit (C15-1447-699)
Price: $879.43List Price: $977.14Immunogen TPA-induced transmembrane protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA043328-100ULImmunogen chromosome 3 open reading frame 62 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedAV49111-100ULImmunogen Synthetic peptide directed towards the C terminal region of human C3orf64 Application Anti-C3ORF64 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml. -
Add to Cart The item has been addedHPA069696-100ULImmunogen chromosome 3 open reading frame 67 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA043458-100ULSigma-Aldrich
Anti-C4orf19 antibody produced in rabbit (C15-1457-694)
Price: $928.29List Price: $1,031.43Immunogen chromosome 4 open reading frame 19 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA052894-100ULSigma-Aldrich
Anti-C4orf19 antibody produced in rabbit (C15-1461-173)
Price: $928.29List Price: $1,031.43Immunogen chromosome 4 open reading frame 19 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA043383-100ULImmunogen chromosome 4 open reading frame 22 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA047287-100ULImmunogen chromosome 4 open reading frame 46 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
