-
HPA054753-100UL
Sigma-Aldrich
Anti-C8orf44 antibody produced in rabbit (C15-1461-780)
Price: $928.29List Price: $1,031.43Immunogen chromosome 8 open reading frame 44 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA075134-100ULImmunogen chromosome 8 open reading frame 46 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization
-
HPA025068-100UL
Sigma-Aldrich
Anti-C8orf48 antibody produced in rabbit (C15-1450-930)
Price: $879.43List Price: $977.14The gene C8orf48 (chromosome 8 open reading frame 48) is mapped to human chromosome 8p and is not well-characterized. It is one of the genes which is differentially regulated in senescent hMSCs (human mesenchymal stem cells). -
HPA026107-100UL
Sigma-Aldrich
Anti-C8orf48 antibody produced in rabbit (C15-1451-021)
Price: $879.43List Price: $977.14The gene encoding chromosome 8 open reading frame 48 (C8orf48) is localized on human chromosome 8p22. Immunogen Uncharacterized protein C8orf48 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas -
HPA027431-100UL
Sigma-Aldrich
Anti-C8orf48 antibody produced in rabbit (C15-1451-491)
Price: $879.43List Price: $977.14The gene encoding chromosome 8 open reading frame 48 (C8orf48) is localized on human chromosome 8p22. Immunogen Uncharacterized protein C8orf48 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas -
HPA027440-100UL
Sigma-Aldrich
Anti-C8orf48 antibody produced in rabbit (C15-1451-495)
Price: $879.43List Price: $977.14The gene encoding chromosome 8 open reading frame 48 (C8orf48) is localized on human chromosome 8p22. Immunogen Uncharacterized protein C8orf48 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas -
HPA024667-100UL
Sigma-Aldrich
Anti-C8orf58 antibody produced in rabbit (C15-1450-847)
Price: $879.43List Price: $977.14The gene C8orf58 (chromosome 8 open reading frame 58) is mapped to human chromosome 8p21.3. -
HPA028286-100UL
Sigma-Aldrich
Anti-C8orf58 antibody produced in rabbit (C15-1451-771)
Price: $879.43List Price: $977.14The gene C8orf58 (chromosome 8 open reading frame 58) is mapped to human chromosome 8p21.3. -
HPA044805-100UL
Sigma-Aldrich
Anti-C8orf59 antibody produced in rabbit (C15-1458-284)
Price: $928.29List Price: $1,031.43Immunogen chromosome 8 open reading frame 59 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA071903-100UL
Sigma-Aldrich
Anti-C8orf59 antibody produced in rabbit (C15-1466-131)
Price: $928.29List Price: $1,031.43Immunogen chromosome 8 open reading frame 59 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA021439-100UL
Sigma-Aldrich
Anti-C9orf116 antibody produced in rabbit (C15-1449-864)
Price: $879.43List Price: $977.14C9orf116 (chromosome 9 open reading frame 116) is commonly referred to as PIERCE1 (p53 induced expression in rb-null cells protein 1). Immunogen UPF0691 protein C9orf116 recombinant protein epitope signature tag (PrEST) Application All Prestige -
HPA065287-100UL
Sigma-Aldrich
Anti-C9orf116 antibody produced in rabbit (C15-1464-850)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to chromosome 9 open reading frame 116 Sequence MAEECPRACAEPVAPKATAPPERTSDYYRVSADLPGRFNNPGWFRGYRTQKAVSVYRTSN Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by