Cell Culture Reagents

CD137 (4-1BB) is a member of the tumor necrosis factor (TNF) receptor superfamily. It is a type I transmembrane glycoprotein expressed on the cell surface of activated splenic T cells and thymocytes.

CD19 is a 95kDa protein localized on the surface of nearly all B lymphocytes, and is considered to be the specific surface marker for B cells. This protein belongs to the immunoglobulin (Ig) superfamily with a cytoplasmic region of ~240 amino

CD27, a member of tumour necrosis factor receptor superfamily is mainly responsible for regulation of cell proliferation and cell death. CD27 and its ligand CD70 expresses mainly on lymphocytes.

Immunogen cell division cycle 20 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen cell division cycle 20 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

The gene CDC37L1 (Hsp90 co-chaperone Cdc37-like 1) is mapped to human chromosome 9p24.1.

Immunogen CDC45-related protein recombinant protein epitope signature tag (PrEST) Application Anti-CDC45L antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is

Immunogen cell division cycle 6 homolog (S. cerevisiae) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen Recombinant protein corresponding to cell division cycle 6 Sequence RLNQVSRDQVLDNAAVQFCARKVSAVSGDVRKALDVCRRAIEIVESDVKSQTILKPLSECKSPSEPLIPKRVGLIHISQVISEVDGNRM Application All Prestige Antibodies Powered by Atlas Antibodies are developed

Immunogen cadherin 18, type 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Cadherins, calcium-dependent adhesion molecules, are a class of type-1 transmembrane proteins involved in cell adhesion where in they ensure that cells within tissues are bound together. P-cadherin (placental) (CDH3) is an adhesion glycoprotein

Immunogen Cadherin-3 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by