Cell Culture Reagents

Immunogen Recombinant protein corresponding to cholinergic receptor nicotinic delta subunit Sequence LVRRSSSLGYISKAEEYFLLKSRSDLMFEKQSERHGLARRLTTARRPPASSEQAQQELFNELKPAVDGANFIVNHMRDQNNYNEEKDSWNRV Application All Prestige Antibodies Powered by Atlas

Immunogen Recombinant protein corresponding to cholinergic receptor nicotinic delta subunit Sequence GLNEEERLIRHLFQEKGYNKELRPVAHKEESVDVALALTLSNLISLKEVEET Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by

Immunogen chromosome transmission fidelity factor 18 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen chromosome transmission fidelity factor 18 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen cell death-inducing DFFA-like effector b Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

The gene CIDEC (cell death-inducing DFFA-like effector protein C) is mapped to human chromosome 3p25. It belongs to cell-death-inducing DNA-fragmentation-factor (DFF45)-like effector family.

Cell death-inducing DFFA-like effector protein C (CIDEC) is localized on the surface of lipid droplets. The gene encoding it is localized on human chromosome 6.

Immunogen chemokine-like factor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen creatine kinase, muscle recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen cyclin and CBS domain divalent metal cation transport mediator 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

Immunogen Uncharacterized protein C1orf31 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Component of oligomeric golgi complex 5 (COG5) is a 90kDa protein which is a part of the conserved oligomeric golgi (COG) complex. The gene encoding it is localized on human chromosome 7q31.