-
HPA027367-100UL
Sigma-Aldrich
Anti-CRP antibody produced in rabbit (C15-1451-454)
Price: $977.14List Price: $1,085.71Immunogen C-reactive protein Precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA027396-100UL
Sigma-Aldrich
Anti-CRP antibody produced in rabbit (C15-1451-469)
Price: $879.43List Price: $977.14Immunogen C-reactive protein Precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA036762-100UL
Sigma-Aldrich
Anti-CRX antibody produced in rabbit (C15-1454-534)
Price: $928.29List Price: $1,031.43Immunogen cone-rod homeobox recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the -
HPA036763-100UL
Sigma-Aldrich
Anti-CRX antibody produced in rabbit (C15-1454-535)
Price: $928.29List Price: $1,031.43Immunogen cone-rod homeobox recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the -
HPA022016-100ULImmunogen Recombinant protein corresponding to crystallin beta A1 Sequence METQAEQQELETLPTTKMAQTNPTPGSLGPWKITIYDQENFQGKRMEFTSSCPNVSERSFDNVRSLKVES Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the
-
HPA062293-100ULImmunogen Recombinant protein corresponding to crystallin beta A2 Sequence GYQYVLERDRHSGEFCTYGELGTQAHTGQLQSIRRVQH Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project
-
HPA071178-100ULImmunogen crystallin, beta A4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
-
HPA055840-100ULImmunogen crystallin, beta B3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
-
HPA041269-100ULImmunogen Recombinant protein corresponding to crystallin gamma D Sequence REDYRGQMIEFTEDCSCLQDRFRFNEI Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a
-
HPA039487-100ULImmunogen cysteine sulfinic acid decarboxylase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,
-
HPA012323-100ULCSF1R (Colony stimulating factor 1 receptor), a type III receptor tyrosine kinase, is a member of the platelet-derived growth factor (PDGF) receptor family. Structurally, it is composed of five immunoglobulin-like domains, a transmembrane domain, a
-
HPA057404-100UL
Sigma-Aldrich
Anti-CSF2 antibody produced in rabbit (C15-1462-651)
Price: $928.29List Price: $1,031.43Immunogen colony stimulating factor 2 (granulocyte-macrophage) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive