-
Add to Cart The item has been addedHPA062006-100ULSigma-Aldrich
Anti-CSF2 antibody produced in rabbit (C15-1463-959)
Price: $928.29List Price: $1,031.43Immunogen colony stimulating factor 2 (granulocyte-macrophage) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA035953-100ULSigma-Aldrich
Anti-CSN3 antibody produced in rabbit (C15-1454-110)
Price: $928.29List Price: $1,031.43Immunogen casein kappa recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA035954-100ULSigma-Aldrich
Anti-CSN3 antibody produced in rabbit (C15-1454-111)
Price: $928.29List Price: $1,031.43Immunogen casein kappa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
Add to Cart The item has been addedHPA049529-100ULSigma-Aldrich
Anti-CSPG5 antibody produced in rabbit (C15-1459-990)
Price: $928.29List Price: $1,031.43Immunogen chondroitin sulfate proteoglycan 5 (neuroglycan C) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA067818-100ULSigma-Aldrich
Anti-CSPG5 antibody produced in rabbit (C15-1465-376)
Price: $928.29List Price: $1,031.43Immunogen chondroitin sulfate proteoglycan 5 (neuroglycan C) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA071779-100ULSigma-Aldrich
Anti-CSPG5 antibody produced in rabbit (C15-1466-099)
Price: $928.29List Price: $1,031.43Immunogen chondroitin sulfate proteoglycan 5 (neuroglycan C) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA017905-100ULCysteine-serine-rich nuclear protein 3 (CSRNP3) contains cysteine- and serine-rich regions. It also has a transcriptional activation domain. -
Add to Cart The item has been addedHPA031075-100ULThe CTGF (connective tissue growth factor) gene is mapped to human chromosome 6q23.2. -
Add to Cart The item has been addedHPA004133-100ULImmunogen Recombinant protein corresponding to cubilin Sequence PNGDSSCNQGDYLVLRNGPDIYSPPLGPPGGNGHFCGSHASSTLFTSDNQMFVQFISDHSNEGQGFKIKYEAKSLACGGNVYIHDADSAGYVTSPNHPHNYPPHADCIWILAAPPETRIQLQFEDRFDIEVTPNCTSNYL Application All Prestige Antibodies Powered -
Add to Cart The item has been addedAV40323-100ULSigma-Aldrich
Anti-CUGBP2 antibody produced in rabbit (C15-1341-218)
Price: $759.43List Price: $843.81CUGBP2 (ETR-3/NAPOR/BRUNOL3) is an RNA-binding protein, posttranscriptional controller of gene expression, that regulates key cellular responses such as apoptosis by binding to AU-rich sequences in the mRNA of important genes such as COX-2 and -
Add to Cart The item has been addedAV40324-100ULSigma-Aldrich
Anti-CUGBP2 antibody produced in rabbit (C15-1341-219)
Price: $898.29List Price: $998.10CUGBP2 (ETR-3/NAPOR/BRUNOL3) is an RNA-binding protein, posttranscriptional controller of gene expression, that regulates key cellular responses such as apoptosis by binding to AU-rich sequences in the mRNA of important genes such as COX-2 and -
Add to Cart The item has been addedHPA064584-100ULImmunogen cullin 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human
