Cell Culture Reagents

The three DVL isoforms display high sequence homology and have conserved DIX, PDZ and DEP domains required for GSK3&#946 inactivation. DVL1 is highly expressed in adult and fetal tissues such as skeletal muscle and pancreas but is also found in

E2F transcription factors are key regulators of cell growth, differentiation and cell death. E2F transcription factor 3 (E2F3) can be induced by DNA damage through transcriptional and posttranslational mechanisms wherein it functions as a master

Immunogen Recombinant protein corresponding to E2F transcription factor 3 Sequence MRKGIQPALEQYLVTAGGGEGAAVVAAAAAASMDKRALLASPGFAAAAAAAAAPGAYIQILTTNTSTTSCSSSLQ Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Immunogen E2F transcription factor 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen Synthetic peptide directed towards the C terminal region of human E2F4 Application Rabbit Anti-E2F4 antibody can be used for western blot (2.0&#956g/ml) and IHC (4-8&#956g/ml) applications.

Immunogen E2F transcription factor 4, p107/p130-binding Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen E2F transcription factor 5, p130-binding Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen E2F transcription factor 5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen Recombinant protein corresponding to E2F transcription factor 6 Sequence AVKAPAETRLDVPAPREDSITVHIRSTNGPIDVYLCEVEQGQTSNKRSEGVGTSSSESTHPEGPEEEENPQQSEELLEVSN Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

E2F transcription factors are key regulators of cell growth, differentiation and cell death. E2F transcription factor 7 (E2F7) which is highly expressed during mid to late S-phase binds to the promoter regions of and represses G(1)/S-regulated

Immunogen E2F transcription factor 7 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen ECSIT homolog (Drosophila) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are