-
HPA013844-100ULImmunogen family with sequence similarity 3, member D recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a
-
HPA041159-100ULImmunogen family with sequence similarity 45, member A recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a
-
HPA067140-100ULImmunogen family with sequence similarity 46, member A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive
-
AV53723-100UL
Sigma-Aldrich
Anti-FAM46C antibody produced in rabbit (C15-1341-884)
Price: $898.29List Price: $998.10Immunogen Synthetic peptide directed towards the middle region of human FAM46C Sequence Synthetic peptide located within the following region: LIATKNPEEIRGGGLLKYSNLLVRDFRPTDQEEIKTLERYMCSRFFIDFP Physical form Purified antibody supplied in 1x PBS -
HPA054049-100UL
Sigma-Aldrich
Anti-FAM46C antibody produced in rabbit (C15-1461-544)
Price: $928.29List Price: $1,031.43Immunogen family with sequence similarity 46, member C recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA059362-100ULImmunogen family with sequence similarity 46, member D Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive
-
HPA000610-100ULImmunogen Protein FAM47A recombinant protein epitope signature tag (PrEST) Application Anti-FAM47A antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by
-
HPA046829-100UL
Sigma-Aldrich
Anti-FAM47B antibody produced in rabbit (C15-1459-020)
Price: $928.29List Price: $1,031.43Immunogen family with sequence similarity 47, member B recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA050996-100UL
Sigma-Aldrich
Anti-FAM47B antibody produced in rabbit (C15-1460-483)
Price: $928.29List Price: $1,031.43Immunogen family with sequence similarity 47, member B recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA053331-100ULImmunogen family with sequence similarity 47, member E recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a
-
HPA036452-100UL
Sigma-Aldrich
Anti-FAM53A antibody produced in rabbit (C15-1454-365)
Price: $928.29List Price: $1,031.43Immunogen family with sequence similarity 53, member A recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA058138-100UL
Sigma-Aldrich
Anti-FAM53A antibody produced in rabbit (C15-1462-843)
Price: $928.29List Price: $1,031.43Immunogen family with sequence similarity 53, member A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive