Cell Culture Reagents

Immunogen insulin-like growth factor binding protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen insulin-like growth factor binding protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen insulin-like growth factor binding protein 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Recombinant protein corresponding to insulin like growth factor binding protein 5 Sequence DRRKKLTQSKFVGGAENTAHPRIISAPEMRQESEQGPCRRHMEASLQELKASPRMV Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Immunogen Insulin-like growth factor-binding protein 6 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project

Immunogen IGF-like family member 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen IGF-like family member 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen immunoglobulin-like and fibronectin type III domain containing 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

IKZF5 (IKAROS family zinc finger 5), also called Pegasus, belongs to the Ikaros family of proteins, and shares the highest homology with Helios protein. It shares its C-terminal dimerization domain with other Ikaros family members, but has

Immunogen IKAROS family zinc finger 5 (Pegasus) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Interleukin-18 (IL18) is a cofactor that belongs to the IL-1 family. It is expressed in many mammalian cells/tissues like liver, adipose tissue and skeletal muscle.

Immunogen interleukin 18 binding protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in