Cell Culture Reagents

IL2 (interleukin 2) is a pro-inflammatory cytokine, which is predominantly synthesized by activated T-cells and dendritic cells (DCs). T-cells also act as effector of IL-2 as they contain the interleukin 2 receptor (IL2R).

Interleukin-2 (IL-2) is a cytokine produced by activated T cells in response to antigen stimulation. IL-2 is important for proliferation of lymphocytes, natural killer cells and macrophages and in the differentiation of CD4 + cells into Th1 and Th2

Interleukin-2 (IL-2) is a cytokine produced by activated T cells in response to antigen stimulation. IL-2 is important for proliferation of lymphocytes, natural killer cells and macrophages and in the differentiation of CD4 + cells into Th1 and Th2

Interleukin-2 (IL-2) is a cytokine produced by activated T cells in response to antigen stimulation. IL-2 is important for proliferation of lymphocytes, natural killer cells and macrophages and in the differentiation of CD4 + cells into Th1 and Th2

Interleukin-4 (IL-4) is a T cell derived chemokine that stimulates the Th2 mediated immune response and proliferation of B cells. The effects of IL-4 are mediated by two types of receptors, type I receptor consisting of IL-4R&#945 and common

Anti-Interleukin 6 (IL-6) is produced in rabbit using purified human recombinant IL-6 produced in E. coli as the immunogen.

Interleukin-7 (IL-7) is a stromal-cell derived cytokine that is important in the development of adaptive immunity and maintenance of T cells and B cells. The cognate receptor that binds IL-7 is the IL-7 receptor complex, made up of IL-7 R &#945

Interleukin 8 (IL-8) is an 8kD, 72 amino acid residue containing cytokine that belongs to C-X-C chemokine family . The IL-8 gene is mapped to human chromosome 4q13.

IP6K2 (inositol hexakisphosphate kinase 2) gene is mapped to human chromosome 3p21.31.

Immunogen Recombinant protein corresponding to inositol hexakisphosphate kinase 2 Sequence RFEEDEDRNLCLIAYPLKGDHGIVDIVDNSDCEPKSKLLRWTTNKKHHVLETEKTPKDWVRQHRKEEK Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Immunogen interferon regulatory factor 2 binding protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as

Immunogen interferon regulatory factor 2 binding protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive