-
HPA027815-100UL
Sigma-Aldrich
Anti-IRF2BP2 antibody produced in rabbit (C15-1451-621)
Price: $879.43List Price: $977.14Immunogen interferon regulatory factor 2 binding protein 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as -
HPA062269-100UL
Sigma-Aldrich
Anti-IRF2BP2 antibody produced in rabbit (C15-1464-038)
Price: $928.29List Price: $1,031.43Immunogen interferon regulatory factor 2 binding protein 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA046433-100ULImmunogen Recombinant protein corresponding to insulin receptor substrate 1 Sequence RKRTHSAGTSPTITHQKTPSQSSVASIEEYTEMMPAYPPGGGSGGRLPGHRHSAFVPTRSYPEEGLEMHPL Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated
-
HPA054664-100ULImmunogen insulin receptor substrate 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
-
HPA017372-100ULImmunogen insulin receptor substrate 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
-
AV53716-100UL
Sigma-Aldrich
Anti-ISYNA1 antibody produced in rabbit (C15-1341-883)
Price: $898.29List Price: $998.10Immunogen Synthetic peptide directed towards the N terminal region of human ISYNA1 Application Anti-ISYNA1 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL. Applications in which this antibody has been -
HPA007931-100UL
Sigma-Aldrich
Anti-ISYNA1 antibody produced in rabbit (C15-1447-005)
Price: $879.43List Price: $977.14Immunogen inositol-3-phosphate synthase 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA008232-100UL
Sigma-Aldrich
Anti-ISYNA1 antibody produced in rabbit (C15-1447-086)
Price: $879.43List Price: $977.14Immunogen inositol-3-phosphate synthase 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA041391-100ULImmunogen isovaleryl-CoA dehydrogenase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
-
HPA063889-100ULImmunogen jumonji, AT rich interactive domain 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive
-
HPA031172-100UL
Sigma-Aldrich
Anti-JKAMP antibody produced in rabbit (C15-1453-011)
Price: $889.20List Price: $988.00Immunogen JNK1/MAPK8-associated membrane protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA071650-100UL
Sigma-Aldrich
Anti-JKAMP antibody produced in rabbit (C15-1466-078)
Price: $928.29List Price: $1,031.43Immunogen JNK1/MAPK8-associated membrane protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive