-
HPA056175-100UL
Sigma-Aldrich
Anti-JMJD1C antibody produced in rabbit (C15-1462-266)
Price: $928.29List Price: $1,031.43Immunogen jumonji domain containing 1C Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA066195-100UL
Sigma-Aldrich
Anti-JMJD1C antibody produced in rabbit (C15-1465-044)
Price: $928.29List Price: $1,031.43Immunogen jumonji domain containing 1C Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA027260-100UL
Sigma-Aldrich
Anti-JMJD4 antibody produced in rabbit (C15-1451-394)
Price: $879.43List Price: $977.14Immunogen jumonji domain containing 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA052861-100UL
Sigma-Aldrich
Anti-JMJD4 antibody produced in rabbit (C15-1461-165)
Price: $928.29List Price: $1,031.43Immunogen jumonji domain containing 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA059156-100ULImmunogen jumonji domain containing 6 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
-
HPA046184-100UL
Sigma-Aldrich
Anti-JRKL antibody produced in rabbit (C15-1458-764)
Price: $928.29List Price: $1,031.43Immunogen JRK-like Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human -
HPA060341-100UL
Sigma-Aldrich
Anti-JRKL antibody produced in rabbit (C15-1463-510)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to JRK-like Sequence RFKQRHSIREINIRNERLNGDETAVEDFCNNFRDFIERENLQPE Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and -
HPA063029-100ULImmunogen jun D proto-oncogene Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
-
HPA000452-100UL
Sigma-Aldrich
Anti-JUP antibody produced in rabbit (C15-1444-948)
Price: $879.43List Price: $977.14Immunogen Keratin 17, type I recombinant protein epitope signature tag (PrEST). Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
HPA000453-100UL
Sigma-Aldrich
Anti-JUP antibody produced in rabbit (C15-1444-949)
Price: $879.43List Price: $977.14Immunogen Keratin, type I cytoskeletal 17 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA032047-100UL
Sigma-Aldrich
Anti-JUP antibody produced in rabbit (C15-1453-355)
Price: $889.20List Price: $988.00Immunogen junction plakoglobin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
GW21213-50UGImmunogen Immunogen Sequence: GI # 10047128 , sequence 280-375 Recombinant potassium channel modulatory factor Application Anti-KCMF1 antibody produced in chicken is suitable for western blotting analysis at a dilution of 1:500, for tissue or cell