-
Add to Cart The item has been addedE8897-100ULMonoclonal Anti-Ezrin antibody produced in mouse (C15-1356-950)
Price: $855.43List Price: $950.48Ezrin is a member of the best studied member of the ERM family of proteins. The ERM family regulates the dynamic cell membrane functions such as endocytosis, exocytosis, and transmembrane and other cortical signalling pathways. -
Add to Cart The item has been addedF5766-.2MLMonoclonal Anti-Folic Acid antibody produced in mouse (C15-1425-072)
Price: $932.57List Price: $1,036.19Monoclonal Anti-Folic Acid (mouse IgG2b isotype) is derived from the hybridoma produced from the fusion of mouse myeloma cells and splenocytes of an immunized mouse. The normal range for folate in serum is 3-13 ng/ml. -
Add to Cart The item has been addedF5766-.5MLMonoclonal Anti-Folic Acid antibody produced in mouse (C15-1425-073)
Price: $1,780.22List Price: $1,978.02Monoclonal Anti-Folic Acid (mouse IgG2b isotype) is derived from the hybridoma produced from the fusion of mouse myeloma cells and splenocytes of an immunized mouse. The normal range for folate in serum is 3-13 ng/ml. -
Add to Cart The item has been addedAMAB91432-100ULMonoclonal Anti-PCOLCE antibody produced in mouse (C15-1318-850)
Price: $977.14List Price: $1,085.71Immunogen Recombinant protein corresponding to procollagen C-endopeptidase enhancer Sequence PKSQPPEKTEESPSAPDAPTCPKQCRRTGTLQSNFCASSLVVTATVKSMVREPGEGLAVTVSLIGAYKTGGLDLPS Application All Prestige Antibodies Powered by Atlas Antibodies are developed -
Add to Cart The item has been addedAMAB91487-100ULMONOCLONAL ANTI-TNFRSF18 ANTIBODY PRODUCED IN MOUSE (C15-1318-878)
Price: $977.14List Price: $1,085.71Immunogen Recombinant protein corresponding to Tnf receptor superfamily member 18 Sequence QFPEEERGERSAEEKGR Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as -
Add to Cart The item has been addedAMAB90928-100ULMonoclonal Anti-VWF antibody produced in mouse (C15-1318-602)
Price: $977.14List Price: $1,085.71Immunogen von Willebrand factor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedAMAB90931-100ULMonoclonal Anti-VWF antibody produced in mouse (C15-1318-603)
Price: $977.14List Price: $1,085.71Immunogen von Willebrand factor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedD123-00Mouse (Virus Free) Serum Sterile 10mL
Price: $1,275.73List Price: $1,417.48pH: normal Immunoelectrophoresis: normal Hemoglobin: normal IgG Concentration: normal -
Add to Cart The item has been addedD424-04Mouse C57 Plasma NS In Na EDTA 10mL
Price: $6,237.36List Price: $6,930.40pH: normal Immunoelectrophoresis: normal Hemoglobin: normal IgG Concentration: normal -
Add to Cart The item has been addedD508-03-0500Mouse Plasma Sterile In Na Citrate 500mL
Price: $6,772.62List Price: $7,525.13pH: normal Immunoelectrophoresis: normal Hemoglobin: normal IgG Concentration: normal -
Add to Cart The item has been addedD108-00-1000Mouse Serum (sterile) 1L
Price: $13,909.52List Price: $15,455.02pH: normal Immunoelectrophoresis: normal Hemoglobin: normal IgG Concentration: normal -
Add to Cart The item has been addedD108-00-0500Mouse Serum (sterile) 500mL
Price: $6,891.57List Price: $7,657.30pH: normal Immunoelectrophoresis: normal Hemoglobin: normal IgG Concentration: normal
