-
HPA054615-100UL
Anti-C19orf57 antibody produced in rabbit (C15-1461-735)
Price: $928.29List Price: $1,031.43Immunogen chromosome 19 open reading frame 57 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA043414-100UL
Anti-C19orf60 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen chromosome 19 open reading frame 60 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA042001-100UL
Anti-C19orf66 antibody produced in rabbit
Price: $928.29List Price: $1,031.43C19ORF66, also known as repressor of yield of dengue virus (RyDEN) , is mapped to human chromosome 19p13.2. -
HPA027499-100UL
Anti-C1orf106 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Uncharacterized protein C1orf106 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA027110-100UL
Anti-C1orf109 antibody produced in rabbit (C15-1451-324)
Price: $879.43List Price: $977.14Immunogen Uncharacterized protein C1orf109 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA027127-100UL
Anti-C1orf109 antibody produced in rabbit (C15-1451-330)
Price: $879.43List Price: $977.14Immunogen Uncharacterized protein C1orf109 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA045779-100UL
Anti-C1ORF189 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen chromosome 1 open reading frame 189 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA049684-100UL
Anti-C1orf194 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen chromosome 1 open reading frame 194 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA045602-100UL
Anti-C1orf204 antibody produced in rabbit (C15-1458-578)
Price: $928.29List Price: $1,031.43Immunogen chromosome 1 open reading frame 204 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA051028-100UL
Anti-C1orf204 antibody produced in rabbit (C15-1460-499)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to chromosome 1 open reading frame 204. Sequence SGVDFPQVSAWMRALPSPDCPGLRTTGEQMQKLLLKENKVKTRKSKRRSGEGSHLTTSILEQ Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated -
HPA026831-100UL
Anti-C1orf21 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Uncharacterized protein C1orf21 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA028299-100UL
Anti-C1orf216 antibody produced in rabbit (C15-1451-775)
Price: $879.43List Price: $977.14Immunogen UPF0500 protein C1orf216 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported