Rabbit Plasma

The gene C21orf91 (protein EURL homolog) is mapped to human chromosome 21q21. The gene encodes a cytosolic protein.

Immunogen chromosome 21 open reading frame 91 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

The gene C22orf29 is also known as BOP. It may act as a novel BH3-only factor that can interacts with the regulatory network of Bcl-2 family members to regulate intrinsic apoptotic signaling.

Specificity Note: The Ensemble Gene ID has changed from ENSG00000185838 in the 46:36 release of the database to ENSG00000215012 in the 48:36 release of the database. Immunogen Uncharacterized protein C22orf29 recombinant protein epitope signature

Immunogen chromosome 22 open reading frame 39 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

The gene C2orf66 is mapped to human chromosome 2. Immunogen Uncharacterized protein C2orf66 Precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by

Immunogen chromosome 3 open reading frame 20 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen chromosome 3 open reading frame 52 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen TPA-induced transmembrane protein recombinant protein epitope signature tag (PrEST) Sequence AQPSQPVDELELSVLERQPEENTPLNGADKVFPSLDEEVPPAEANKESPWSSCNKNVVGRCK Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Immunogen TPA-induced transmembrane protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen chromosome 4 open reading frame 46 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen chromosome 5 open reading frame 22 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are