-
HPA004003-100UL
Sigma-Aldrich
Anti-CXorf67 antibody produced in rabbit (C15-1446-130)
Price: $879.43List Price: $977.14Immunogen chromosome X open reading frame 67 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA006128-100UL
Sigma-Aldrich
Anti-CXorf67 antibody produced in rabbit (C15-1446-564)
Price: $879.43List Price: $977.14Immunogen chromosome X open reading frame 67 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
D0942-100UGSpecificity DHFR and DHFR fusion proteins. The epitope resides within amino acids 171-185 of mouse DHFR.
-
HPA060089-100UL
Sigma-Aldrich
Anti-EED antibody produced in rabbit (C15-1463-451)
Price: $928.29List Price: $1,031.43Immunogen embryonic ectoderm development Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
HPA061140-100UL
Sigma-Aldrich
Anti-EED antibody produced in rabbit (C15-1463-707)
Price: $928.29List Price: $1,031.43Immunogen embryonic ectoderm development Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
HPA056061-100ULImmunogen eukaryotic elongation factor 2 kinase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive
-
HPA053668-100ULImmunogen endonuclease/exonuclease/phosphatase family domain containing 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the
-
HPA050716-100ULImmunogen Recombinant protein corresponding to EGF like domain multiple 7 Sequence RGDTCQSGVDSAMKEEVQRLQSRVDLLEEKLQLVLAPLHSLASQALEHGLPDPGSLLVHSFQQLGRIDSLSEQISFLEEQLGSCSCKKD Application All Prestige Antibodies Powered by Atlas Antibodies are
-
HPA077654-100ULImmunogen erythropoietin receptor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
-
HPA039700-100ULImmunogen esterase D recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most
-
HPA047083-100UL
Sigma-Aldrich
Anti-ESF1 antibody produced in rabbit (C15-1459-112)
Price: $928.29List Price: $1,031.43Immunogen ESF1, nucleolar pre-rRNA processing protein, homolog (S. cerevisiae) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas -
HPA050396-100UL
Sigma-Aldrich
Anti-ESF1 antibody produced in rabbit (C15-1460-283)
Price: $928.29List Price: $1,031.43Immunogen ESF1 nucleolar pre-rRNA processing protein homolog Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive