Rabbit Plasma

Immunogen Fibronectin type III domain-containing protein 8 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as

Immunogen Fibronectin type-III domain-containing protein C5orf40 gene recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

FNDC9 (fibronectin type III domain containing 9) has a differential level of expression between grade II oligodendrogliomas and ependymoma. Immunogen Fibronectin type-III domain-containing protein C5orf40 recombinant protein epitope signature tag

Immunogen FRAS1 related extracellular matrix 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen FERM and PDZ domain-containing protein 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

FYN (proto-oncogene, Src family tyrosine kinase) is located in human chromosome 6q21. Fyn is a non-receptor type tyrosine kinase also called as tau kinase, which belongs to the Src family.

Immunogen FYN proto-oncogene, Src family tyrosine kinase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen growth differentiation factor 11 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen growth differentiation factor 11 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

GDF15 (growth differentiation factor 15) is a part of the transforming growth factor-&#946 (TGF&#946) or bone morphogenetic protein (BMP) superfamily. This gene resides in human chromosomal locus 19p12.

Immunogen Recombinant protein corresponding to growth differentiation factor 15 Sequence EVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHC Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Immunogen growth differentiation factor 6 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are