-
Add to Cart The item has been addedHPA027342-100ULImmunogen vascular endothelial growth factor D recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedHPA022988-100ULSigma-Aldrich
Anti-VPS53 antibody produced in rabbit (C15-1450-199)
Price: $879.43List Price: $977.14Immunogen Vacuolar protein sorting-associated protein 53 homolog recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
Add to Cart The item has been addedHPA024446-100ULSigma-Aldrich
Anti-VPS53 antibody produced in rabbit (C15-1450-763)
Price: $879.43List Price: $977.14Immunogen Vacuolar protein sorting-associated protein 53 homolog recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
Add to Cart The item has been addedHPA050603-100ULImmunogen WD repeat and FYVE domain containing 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedHPA030063-100ULSigma-Aldrich
Anti-YTHDF2 antibody produced in rabbit (C15-1452-513)
Price: $879.43List Price: $977.14Immunogen Recombinant protein corresponding to YTH N6-methyladenosine RNA binding protein 2 Sequence TQPLPPPPPQPAQLSVQQQAAQPTRWVAPRNRGSGFGHNGVDGNGVGQSQAGSGSTPSEPHPVLEKLRSIN Application All Prestige Antibodies Powered by Atlas Antibodies are -
Add to Cart The item has been addedHPA054080-100ULSigma-Aldrich
Anti-YTHDF2 antibody produced in rabbit (C15-1461-558)
Price: $928.29List Price: $1,031.43Immunogen YTH N(6)-methyladenosine RNA binding protein 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA059621-100ULSigma-Aldrich
Anti-YTHDF2 antibody produced in rabbit (C15-1463-331)
Price: $928.29List Price: $1,031.43YTHDF2 (YTH domain family 2) is also known as an YTH N 6 -methyladenosine(m 6 A) RNA binding protein 2. YTHDF2 gene Is located on human chromosome 1p35. -
Add to Cart The item has been addedHPA063338-100ULImmunogen zinc finger protein 441 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedD406-05-1000Hamster Plasma Non-Sterile In K EDTA 1L
Price: $11,976.61List Price: $13,307.34pH: normal Immunoelectrophoresis: normal Hemoglobin: normal IgG Concentration: normal -
Add to Cart The item has been added401590-50MGNative IgG from rabbit plasma. IgG is a glycoprotein found in serum and tissue fluids. -
Add to Cart The item has been addedD409-01-0100Rabbit Plasma Non-Sterile In ACD 100mL
Price: $1,513.87List Price: $1,682.07pH: normal Immunoelectrophoresis: normal Hemoglobin: normal IgG Concentration: normal -
Add to Cart The item has been addedD409-01-1000Rabbit Plasma Non-Sterile In ACD 1L
Price: $9,856.37List Price: $10,951.52pH: normal Immunoelectrophoresis: normal Hemoglobin: normal IgG Concentration: normal
