Skip to main content

Rabbit Plasma

Compare
  
  • anti-c14orf37 antibody produced in rabbit (c15-1445-341)
    Add to Cart The item has been added
    HPA001580-100UL

    Anti-C14orf37 antibody produced in rabbit (C15-1445-341)

    Price: $879.43
    List Price: $977.14
    Immunogen chromosome 14 open reading frame 37 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization
    Hide Expand
    SKUHPA001580-100UL
    MFR. NameSigma-Aldrich
    Catalog No. C15-1445-341
    Pack Size 100 UL
    Price:
    Price: $879.43
    List Price: $977.14
    Quantity:
     
    Add to Cart The item has been added

    Product Information

    Catalog No.
    C15-1445-341
    Description
    Immunogen chromosome 14 open reading frame 37 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization
  • anti-c14orf37 antibody produced in rabbit (c15-1445-412)
    Add to Cart The item has been added
    HPA001789-100UL

    Anti-C14orf37 antibody produced in rabbit (C15-1445-412)

    Price: $879.43
    List Price: $977.14
    Immunogen Uncharacterized protein C14orf37 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a
    Hide Expand
    SKUHPA001789-100UL
    MFR. NameSigma-Aldrich
    Catalog No. C15-1445-412
    Pack Size 100 UL
    Price:
    Price: $879.43
    List Price: $977.14
    Quantity:
     
    Add to Cart The item has been added

    Product Information

    Catalog No.
    C15-1445-412
    Description
    Immunogen Uncharacterized protein C14orf37 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a
  • anti-c14orf39 antibody produced in rabbit
    Add to Cart The item has been added
    HPA059518-100UL

    Anti-C14orf39 antibody produced in rabbit

    Price: $928.29
    List Price: $1,031.43
    Immunogen chromosome 14 open reading frame 39 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization
    Hide Expand
    SKUHPA059518-100UL
    MFR. NameSigma-Aldrich
    Catalog No. C15-1463-294
    Pack Size 100 UL
    Price:
    Price: $928.29
    List Price: $1,031.43
    Quantity:
     
    Add to Cart The item has been added

    Product Information

    Catalog No.
    C15-1463-294
    Description
    Immunogen chromosome 14 open reading frame 39 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization
  • anti-c15orf39 antibody produced in rabbit (c15-1455-993)
    Add to Cart The item has been added
    HPA039961-100UL

    Anti-C15orf39 antibody produced in rabbit (C15-1455-993)

    Price: $928.29
    List Price: $1,031.43
    Immunogen Uncharacterized protein C15orf39 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
    Hide Expand
    SKUHPA039961-100UL
    MFR. NameSigma-Aldrich
    Catalog No. C15-1455-993
    Pack Size 100 UL
    Price:
    Price: $928.29
    List Price: $1,031.43
    Quantity:
     
    Add to Cart The item has been added

    Product Information

    Catalog No.
    C15-1455-993
    Description
    Immunogen Uncharacterized protein C15orf39 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
  • anti-c15orf39 antibody produced in rabbit (c15-1456-952)
    Add to Cart The item has been added
    HPA041907-100UL

    Anti-C15orf39 antibody produced in rabbit (C15-1456-952)

    Price: $928.29
    List Price: $1,031.43
    Immunogen chromosome 15 open reading frame 39 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization
    Hide Expand
    SKUHPA041907-100UL
    MFR. NameSigma-Aldrich
    Catalog No. C15-1456-952
    Pack Size 100 UL
    Price:
    Price: $928.29
    List Price: $1,031.43
    Quantity:
     
    Add to Cart The item has been added

    Product Information

    Catalog No.
    C15-1456-952
    Description
    Immunogen chromosome 15 open reading frame 39 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization
  • anti-c15orf48 antibody produced in rabbit
    Add to Cart The item has been added
    HPA012943-100UL

    Anti-C15orf48 antibody produced in rabbit

    Price: $879.43
    List Price: $977.14
    Immunogen Recombinant protein corresponding to chromosome 15 open reading frame 48 Sequence TDVILDRKKNPEPWETVDPTVPQKLITINQQWKPIEELQ Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein
    Hide Expand
    SKUHPA012943-100UL
    MFR. NameSigma-Aldrich
    Catalog No. C15-1447-906
    Pack Size 100 UL
    Price:
    Price: $879.43
    List Price: $977.14
    Quantity:
     
    Add to Cart The item has been added

    Product Information

    Catalog No.
    C15-1447-906
    Description
    Immunogen Recombinant protein corresponding to chromosome 15 open reading frame 48 Sequence TDVILDRKKNPEPWETVDPTVPQKLITINQQWKPIEELQ Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein
  • anti-c15orf52 antibody produced in rabbit (c15-1456-227)
    Add to Cart The item has been added
    HPA040484-100UL

    Anti-C15orf52 antibody produced in rabbit (C15-1456-227)

    Price: $928.29
    List Price: $1,031.43
    Immunogen chromosome 15 open reading frame 52 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,
    Hide Expand
    SKUHPA040484-100UL
    MFR. NameSigma-Aldrich
    Catalog No. C15-1456-227
    Pack Size 100 UL
    Price:
    Price: $928.29
    List Price: $1,031.43
    Quantity:
     
    Add to Cart The item has been added

    Product Information

    Catalog No.
    C15-1456-227
    Description
    Immunogen chromosome 15 open reading frame 52 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,
  • anti-c15orf52 antibody produced in rabbit (c15-1456-912)
    Add to Cart The item has been added
    HPA041834-100UL

    Anti-C15orf52 antibody produced in rabbit (C15-1456-912)

    Price: $928.29
    List Price: $1,031.43
    Immunogen chromosome 15 open reading frame 52 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,
    Hide Expand
    SKUHPA041834-100UL
    MFR. NameSigma-Aldrich
    Catalog No. C15-1456-912
    Pack Size 100 UL
    Price:
    Price: $928.29
    List Price: $1,031.43
    Quantity:
     
    Add to Cart The item has been added

    Product Information

    Catalog No.
    C15-1456-912
    Description
    Immunogen chromosome 15 open reading frame 52 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,
  • anti-c15orf53 antibody produced in rabbit
    Add to Cart The item has been added
    HPA041914-100UL

    Anti-C15orf53 antibody produced in rabbit

    Price: $928.29
    List Price: $1,031.43
    Immunogen chromosome 15 open reading frame 53 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,
    Hide Expand
    SKUHPA041914-100UL
    MFR. NameSigma-Aldrich
    Catalog No. C15-1456-957
    Pack Size 100 UL
    Price:
    Price: $928.29
    List Price: $1,031.43
    Quantity:
     
    Add to Cart The item has been added

    Product Information

    Catalog No.
    C15-1456-957
    Description
    Immunogen chromosome 15 open reading frame 53 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,
  • anti-c15orf57 antibody produced in rabbit
    Add to Cart The item has been added
    HPA041688-100UL

    Anti-C15orf57 antibody produced in rabbit

    Price: $928.29
    List Price: $1,031.43
    Immunogen chromosome 15 open reading frame 57 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,
    Hide Expand
    SKUHPA041688-100UL
    MFR. NameSigma-Aldrich
    Catalog No. C15-1456-831
    Pack Size 100 UL
    Price:
    Price: $928.29
    List Price: $1,031.43
    Quantity:
     
    Add to Cart The item has been added

    Product Information

    Catalog No.
    C15-1456-831
    Description
    Immunogen chromosome 15 open reading frame 57 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,
  • anti-c15orf59 antibody produced in rabbit
    Add to Cart The item has been added
    HPA041563-100UL

    Anti-C15orf59 antibody produced in rabbit

    Price: $928.29
    List Price: $1,031.43
    Immunogen chromosome 15 open reading frame 59 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,
    Hide Expand
    SKUHPA041563-100UL
    MFR. NameSigma-Aldrich
    Catalog No. C15-1456-763
    Pack Size 100 UL
    Price:
    Price: $928.29
    List Price: $1,031.43
    Quantity:
     
    Add to Cart The item has been added

    Product Information

    Catalog No.
    C15-1456-763
    Description
    Immunogen chromosome 15 open reading frame 59 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,
  • anti-c15orf61 antibody produced in rabbit
    Add to Cart The item has been added
    HPA062820-100UL

    Anti-C15orf61 antibody produced in rabbit

    Price: $928.29
    List Price: $1,031.43
    Immunogen chromosome 15 open reading frame 61 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization
    Hide Expand
    SKUHPA062820-100UL
    MFR. NameSigma-Aldrich
    Catalog No. C15-1464-200
    Pack Size 100 UL
    Price:
    Price: $928.29
    List Price: $1,031.43
    Quantity:
     
    Add to Cart The item has been added

    Product Information

    Catalog No.
    C15-1464-200
    Description
    Immunogen chromosome 15 open reading frame 61 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Lab - Point of Care

Lab Equipment & Accessories

Chemicals, Stains and Reagents

Medical Equipment

!