-
HPA044636-100UL
Anti-C15orf62 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen chromosome 15 open reading frame 62 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA041114-100UL
Anti-C16orf45 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen chromosome 16 open reading frame 45 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA041136-100UL
Anti-C16orf46 antibody produced in rabbit (C15-1456-541)
Price: $928.29List Price: $1,031.43Immunogen chromosome 16 open reading frame 46 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA041379-100UL
Anti-C16orf46 antibody produced in rabbit (C15-1456-664)
Price: $928.29List Price: $1,031.43Immunogen chromosome 16 open reading frame 46 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA060546-100UL
Anti-C16orf54 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen chromosome 16 open reading frame 54 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA024406-100UL
Anti-C16orf58 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen UPF0420 protein C16orf58 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA051394-100UL
Anti-C16ORF59 antibody produced in rabbit (C15-1460-645)
Price: $928.29List Price: $1,031.43Immunogen chromosome 16 open reading frame 59 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA055389-100UL
Anti-C16orf59 antibody produced in rabbit (C15-1462-000)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to chromosome 16 open reading frame 59 Sequence EKAVRVRRGITKAGERDKAPSLKSRSIVTSSGTTASAPPHSPGQAGGHASDTRPTKGLRQTTVPAKGHPERRLLSVGDGTRVGM Application All Prestige Antibodies Powered by Atlas Antibodies are -
HPA042969-100UL
Anti-C16orf62 antibody produced in rabbit (C15-1457-452)
Price: $928.29List Price: $1,031.43Immunogen chromosome 16 open reading frame 62 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA053547-100UL
Anti-C16orf62 antibody produced in rabbit (C15-1461-369)
Price: $928.29List Price: $1,031.43Immunogen chromosome 16 open reading frame 62 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA049367-100UL
Anti-C16ORF74 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen chromosome 16 open reading frame 74 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA073475-100UL
Anti-C16orf86 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen chromosome 16 open reading frame 86 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization