Rabbit Serum

The gene XKR6 (XK related 6) is mapped to human chromosome 8p23.1.

Immunogen Recombinant protein corresponding to XK related 6 Sequence FVDRRLRRTINILQYVTPTAVGIRYRDGPLLYELLQYESSL Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and

Immunogen exportin 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen exportin 6 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen Zinc finger C3H1 domain-containing protein recombinant protein epitope signature tag (PrEST) Sequence PSRKQNYSSKNENCVEETFEDLLLKYKQIQLELECINKDEKLALSSKEENVQEDPKTLNFEDQTSTDNVSITKDSSKEVAPEEKTQVKTFQAFELKPLRQKLTLPGDKNRLKKVKDGAKPLSL Application

Immunogen zinc finger protein 442 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen zinc finger protein 444 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen zinc finger protein 444 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen Recombinant protein corresponding to zinc finger protein 536 Sequence AFCNFPSDFYKQFGVYPGMVGSGASSSCPNKEPDGKAHSEEDVPILIPETTSKNTTDDLSDIASSEDMDSSKGENNDEEDVETEPEMMTKPL Application All Prestige Antibodies Powered by Atlas Antibodies are

Collagen is classified into a number of structurally and genetically distinct types. We use the nomenclature proposed by Bornstein and Traub.

Corning extracellular matrices (ECMs) enable researchers to mimic in vivo environments for 2D and 3D cell culture applications. Corning offers a broad range of collagen types that are derived from multiple species.

Application EX-CELL 302 is a serum-free medium which has been specifically developed for the long-term growth of transformed Chinese Hamster Ovary (CHO) cells in suspension for the expression of antibodies or protein products. EX-CELL 302 is an