Rabbit Serum

General description We are committed to bringing you greener alternative products, which adhere to one or more of The 12 Principles of Green Chemistry.This antibody is Preservative-free, produced without the harm or sacrifice of animals and

Immunogen Synthetic peptide directed towards the middle region of human CAPNS1 Sequence Synthetic peptide located within the following region: RRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQL Physical form Purified antibody supplied in 1x

CARKD (carbohydrate kinase domain containing) is one of the initially defined proofreading enzymes involved in intermediary metabolism. It is localized to nucleus, mitochondria and cytosol.

Immunogen kinetochore scaffold 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen kinetochore scaffold 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

General description Anti-CBCP2 Antibody detects endogenous levels of total CBCP2 protein. Immunogen The antiserum was produced against synthesized peptide derived from human CBCP2.

General description At the nuclear envelope, the nuclear lamina and heterochromatin are adjacent to the inner nuclear membrane. The protein encoded by this gene binds DNA and is a component of heterochromatin.

Immunogen Synthetic peptide directed towards the N terminal region of human CCND1 Biochem/physiol Actions CCND1 belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance

Immunogen cyclin D3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen cyclin H Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human

General description We are committed to bringing you greener alternative products, which adhere to one or more of The 12 Principles of Green Chemistry.This antibody is Preservative-free, produced without the harm or sacrifice of animals and

General description We are committed to bringing you greener alternative products, which adhere to one or more of The 12 Principles of Green Chemistry.This antibody is Preservative-free, produced without the harm or sacrifice of animals and