Rabbit Serum

Immunogen cytochrome c oxidase subunit VIc Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen cytochrome c oxidase subunit VIIa polypeptide 2 like Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Cytochrome c oxidase polypeptide 8 isoform 3, mitochondrial precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas

The gene CRBN (cereblon) is mapped to human chromosome 3p26.2.

Immunogen Synthetic peptide directed towards the N terminal region of human CRBN Sequence Synthetic peptide located within the following region: DQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDDDSCQVIPVL Physical form Purified antibody supplied in 1x

General description Anti-CRBP III Antibody detects endogenous levels of total CRBP III protein. Immunogen The antiserum was produced against synthesized peptide derived from human CRBP III.

RCOR2 is a part of the LSD1 complex and is known to modulate ESC properties. RCOR2 also substitutes for SOX2 during somatic cell reprogramming.

CREB3L2 (cAMP responsive element binding protein 3-like 2) is also called BBF2 human homolog on chromosome 7 (BBF2H7), and along with old astrocyte specifically induced substance (OASIS) is a member of the cAMP response element-binding protein

Immunogen cAMP responsive element binding protein 3-like 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

General description The previously assigned protein identifier Q4LE28 has been merged into Q92793. Full details can be found on the UniProt database.

CREBZF (cAMP response element binding bZIP (basic leucine zipper) transcription factor), also called as zhangfei (ZF) or small heterodimer partner interacting leucine zipper protein (SMILE), belongs to the mammalian activating transcription factor

General description Anti-CREBZF Antibody detects endogenous levels of total CREBZF protein. Immunogen The antiserum was produced against synthesized peptide derived from human CREBZF.