-
HPA016802-100ULImmunogen fatty acid desaturase domain family, member 6 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a
-
HPA065968-100UL
Sigma-Aldrich
Anti-FAF2 antibody produced in rabbit (C15-1464-993)
Price: $928.29List Price: $1,031.43Immunogen Fas associated factor family member 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA071246-100UL
Sigma-Aldrich
Anti-FAF2 antibody produced in rabbit (C15-1466-009)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to Fas associated factor family member 2 Sequence EGYRVSQALRENTYPFLAMIMLKDRRMTVVGRLEGLIQPDDLINQLTFIMDANQTYLVSERLEREERNQTQVL Application All Prestige Antibodies Powered by Atlas Antibodies are developed -
HPA073828-100UL
Sigma-Aldrich
Anti-FAF2 antibody produced in rabbit (C15-1466-446)
Price: $928.29List Price: $1,031.43Immunogen Fas associated factor family member 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA041370-100UL
Sigma-Aldrich
Anti-FAH antibody produced in rabbit (C15-1456-660)
Price: $928.29List Price: $1,031.43Fumarylacetoacetate hydrolase (FAH) is encoded by the gene mapped to human chromosome 15q25.1. -
HPA044093-100UL
Sigma-Aldrich
Anti-FAH antibody produced in rabbit (C15-1458-017)
Price: $928.29List Price: $1,031.43Immunogen fumarylacetoacetate hydrolase (fumarylacetoacetase) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and -
AV49425-100UL
Sigma-Aldrich
Anti-FAM105A antibody produced in rabbit (C15-1341-746)
Price: $898.29List Price: $998.10FAM105A is a deubiquitinase that is characterized by the presence of ovarian tumor (OTU) domain. It is observed to be overexpressed in human carcinoma cell line, A549. -
HPA046638-100UL
Sigma-Aldrich
Anti-FAM105A antibody produced in rabbit (C15-1458-925)
Price: $928.29List Price: $1,031.43Immunogen family with sequence similarity 105, member A recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA056425-100ULImmunogen family with sequence similarity 106, member A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive
-
HPA066175-100ULImmunogen family with sequence similarity 133, member A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive
-
HPA031743-100UL
Sigma-Aldrich
Anti-FAM135A antibody produced in rabbit (C15-1453-255)
Price: $889.20List Price: $988.00Immunogen family with sequence similarity 135, member A recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA031744-100UL
Sigma-Aldrich
Anti-FAM135A antibody produced in rabbit (C15-1453-256)
Price: $889.20List Price: $988.00Immunogen family with sequence similarity 135, member A recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a