Rabbit Serum

Immunogen homeobox A6 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen 4-hydroxyphenylpyruvate dioxygenase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen 4-hydroxyphenylpyruvate dioxygenase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen histone PARylation factor 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

HSF1 (heat shock transcription factor 1) is a transcriptional protein, which plays an essential role in the heat shock process. It is a multi-domain protein, which is composed of a helix winged-loop helix DNA binding domain (DBD) in its N-terminal,

Immunogen heat shock transcription factor 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

HSF2BP codes for a protein that binds to heat shock transcription factor 2 (HSF2) and may regulate HSF2 activity. Studies have reported that HSF2BP represses the transcriptional functions of BNC1.

Immunogen heat shock transcription factor 2 binding protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen heat shock transcription factor 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen heat shock transcription factor family member 5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Recombinant protein corresponding to heat shock transcription factor family, X-linked 2 Sequence SMARCEERNSRGQDHGLERVPFPPQLQSETYLHPADPSPAWDDPGSTGSPNLRLLTEEIAFQPLAEEASFRRPHPDGDVPPQGEDNLLSLPFPQKLWRLVSSN Application All Prestige Antibodies

Albumin&#8242s primary structure is composed of a single chain of amino acids and the secondary structure is composed of &#945-helix of six turns and 17 disulfide bridges. The tertiary structure is 3D and is composed of three domains I II and III.