-
HPA066973-100UL
Anti-AMH antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to anti-Mullerian hormone Sequence GEDSRLSTARLQALLFGDDHRCFTRMTPALLLLPRSEPAPLPAHGQLDTVPFPPPRPSAELEESPPSADPFLETLT Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated -
HPA019828-100UL
Anti-AMPH antibody produced in rabbit (C15-1449-444)
Price: $879.43List Price: $977.14AMPH (Amphiphysin) is a 128kD peripheral protein highly distributed in nervous system including many neurons, certain endocrine cell types, and spermatocytes. It exists in two isoforms with two different molecular weight 128 and 108kD in the breast -
HPA019829-100UL
Anti-AMPH antibody produced in rabbit (C15-1449-445)
Price: $879.43List Price: $977.14AMPH (Amphiphysin) is a 128kD peripheral protein highly distributed in nervous system including many neurons, certain endocrine cell types, and spermatocytes. It exists in two isoforms with two different molecular weight 128 and 108kD in the breast -
AV36582-100UL
Anti-ANXA6 (AB1) antibody produced in rabbit
Price: $759.43List Price: $843.81Immunogen Synthetic peptide directed towards the C terminal region of human Anxa6 Biochem/physiol Actions ANXA6 is a calcium-dependent, phospholipid-binding protein that belongs to the annexin family. It inhibits the activity of cytoplasmic -
A7549-.2ML
Anti-Apoptosis-Inducing Factor antibody produced in rabbit (C15-1315-422)
Price: $934.29List Price: $1,038.10Apoptosis-Inducing Factor (AIF) is a mitochondrial flavoprotein that can induce apoptosis in isolated nuclei. Studies have reported that AIF can induce the realease of cytochrome c and caspase 9. -
HPA051306-100UL
Anti-AREL1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen KIAA0317 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
AV54598-100UL
Anti-ARF6 antibody produced in rabbit
Price: $898.29List Price: $998.10Immunogen Synthetic peptide directed towards the middle region of human ARF6 Biochem/physiol Actions ARF6 is a member of the human ARF family, which is part of the RAS superfamily. They are small guanine nucleotide-binding proteins that stimulate -
HPA036350-100UL
Anti-ARFGEF3 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen ARFGEF family member 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA061171-100UL
Anti-ASAH2 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen N-acylsphingosine amidohydrolase (non-lysosomal ceramidase) 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA020537-100UL
Anti-ASAP3 antibody produced in rabbit (C15-1449-629)
Price: $879.43List Price: $977.14Immunogen ArfGAP with SH3 domain, ankyrin repeat and PH domain 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
HPA020546-100UL
Anti-ASAP3 antibody produced in rabbit (C15-1449-632)
Price: $879.43List Price: $977.14Immunogen ArfGAP with SH3 domain, ankyrin repeat and PH domain 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
HPA068447-100UL
Anti-ASB18 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen ankyrin repeat and SOCS box containing 18 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive