-
HPA028020-100UL
Sigma-Aldrich
Anti-ODF2L antibody produced in rabbit (C15-1451-686)
Price: $879.43List Price: $977.14Immunogen outer dense fiber of sperm tails 2-like recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA028095-100UL
Sigma-Aldrich
Anti-ODF2L antibody produced in rabbit (C15-1451-709)
Price: $879.43List Price: $977.14Immunogen outer dense fiber of sperm tails 2-like recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA028333-100UL
Sigma-Aldrich
Anti-ODF2L antibody produced in rabbit (C15-1451-786)
Price: $879.43List Price: $977.14Immunogen outer dense fiber of sperm tails 2-like recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA038919-100UL
Sigma-Aldrich
Anti-ODF3 antibody produced in rabbit (C15-1455-507)
Price: $928.29List Price: $1,031.43Immunogen outer dense fiber of sperm tails 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA039241-100UL
Sigma-Aldrich
Anti-ODF3 antibody produced in rabbit (C15-1455-637)
Price: $928.29List Price: $1,031.43Immunogen outer dense fiber of sperm tails 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA067065-100UL
Sigma-Aldrich
ANTI-ODF3L2 ANTIBODY PRODUCED IN RABBIT (C15-1465-213)
Price: $977.14List Price: $1,085.71Immunogen outer dense fiber of sperm tails 3 like 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA067973-100UL
Sigma-Aldrich
Anti-ODF3L2 antibody produced in rabbit (C15-1465-414)
Price: $928.29List Price: $1,031.43Immunogen outer dense fiber of sperm tails 3-like 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA072129-100ULImmunogen outer dense fiber of sperm tails 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization
-
HPA037947-100UL
Sigma-Aldrich
Anti-OLAH antibody produced in rabbit (C15-1454-990)
Price: $928.29List Price: $1,031.43Immunogen oleoyl-ACP hydrolase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
HPA037948-100UL
Sigma-Aldrich
Anti-OLAH antibody produced in rabbit (C15-1454-991)
Price: $928.29List Price: $1,031.43Immunogen oleoyl-ACP hydrolase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
HPA027991-100ULImmunogen Recombinant protein corresponding to olfactomedin like 3 Sequence LVEYMERRLAALEERLAQCQDQSSRHAAELRDFKNKMLPLLEVAEKEREALRTEADTISGRVDRLEREVDYLETQNPALPCVEFDEKVTGGPGTKGKGRRNE Application All Prestige Antibodies Powered by Atlas Antibodies are
-
HPA067673-100ULImmunogen oxoglutarate (alpha-ketoglutarate) receptor 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive