Rabbit Serum

Immunogen phospholipase A2, group V Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

PLA2G6 (phospholipase A2, group VI) localizes in the mitochondria. Immunogen 85 kDa calcium-independent phospholipase A2 recombinant protein epitope signature tag (PrEST) Application Anti-PLA2G6 antibody produced in rabbit, a Prestige Antibody, is

Immunogen Recombinant protein corresponding to phospholipase C delta 3 Sequence EGHQSEGLRRFGGAFAPARCLTIAFKGRRKNLDLAAPTAEEAQRWVRGLTKLRARLDAMSQRERLDHWIHSYLHRADSNQDSKMSFKEIKSLLRMVNVDMNDMYAYLLFK Application All Prestige Antibodies Powered by Atlas

Immunogen phospholipase C, delta 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen phospholipase C, delta 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen Recombinant protein corresponding to phospholipase C eta 2 Sequence AEEDVESGEDAGASRRNGRLVVGSFSRRKKKGSKLKKAASVEEGDEGQDSPGGQSRGATRQKKTMKLSR Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the

Immunogen phospholipase C-like 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen phosphatidylinositol-specific phospholipase C, X domain containing 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas

Immunogen phosphatidylinositol-specific phospholipase C, X domain containing 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas

Immunogen phosphatidylinositol-specific phospholipase C, X domain containing 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas

Immunogen Synthetic peptide directed towards the N terminal region of human PLD3 Application Anti-PLD3 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5&#956g/ml.

Phospholipase D3 (PLD3) is a ubiquitously expressed type 2 transmembrane protein. It is present in the endoplasmic reticulum.