Rabbit Serum

Proline dehydrogenase (oxidase) 1 (PRODH) is a mitochondrial enzyme expressed mainly in the brain. The gene encoding this enzyme is present on human chromosome 22q11.

Immunogen proline dehydrogenase (oxidase) 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen prospero homeobox 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen prospero homeobox 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

The gene PSMB6 (proteasome subunit &#946 6) is mapped to human chromosome 17p13. Immunogen Proteasome subunit beta type-6 Precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies

Immunogen proteasome subunit beta 6 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Lipocalin-type prostaglandin D2 (PGD2) synthase (PTGDS) is responsible for the synthesis of prostaglandin D2 (PGD2). PTGDS belongs to the lipocalin ligand-carrier protein family.

PTGER3 (prostaglandin E receptor 3) gene encodes a seven-transmembrane-spanning protein with multiple C-terminal tails. The gene is mapped to human chromosome 1p31.

Immunogen Prostaglandin F2 receptor negative regulator precursor recombinant protein epitope signature tag (PrEST) Application Anti-PTGFRN antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA)

Immunogen prostaglandin reductase 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen prostaglandin reductase 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen Recombinant protein corresponding to protein tyrosine phosphatase, non-receptor type 18 Sequence EEAPLYSKVTPRAQRPGAHAEDARGTLPGRVPADQSPAGSGAYEDVAGGAQTGGLGFNLRIGRPK Application All Prestige Antibodies Powered by Atlas Antibodies are