-
Add to Cart The item has been addedHPA008752-100ULSigma-Aldrich
Anti-RAD18 antibody produced in rabbit (C15-1447-208)
Price: $879.43List Price: $977.14Immunogen RAD18 E3 ubiquitin protein ligase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA020044-100ULRAD21 (RAD21 homolog, S. pombe ) is a novel nuclear protein located on chromosome 8q24. -
Add to Cart The item has been addedHPA053282-100ULImmunogen RAD21-like 1 (S. pombe) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedHPA051869-100ULImmunogen RAD51 paralog B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
Add to Cart The item has been addedHPA007087-100ULImmunogen DNA repair and recombination protein RAD54B recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA046651-100ULImmunogen ralA binding protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedHPA003892-100ULImmunogen Retinoic acid receptor responder protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA018679-100ULThe gene Ras-specific guanine nucleotide-releasing factor-2 (RASGRF2) is mapped to human chromosome 5q13. It belongs to a family of calcium/calmodulin-regulated guanine-nucleotide exchange factors. -
Add to Cart The item has been addedHPA039389-100ULImmunogen Recombinant protein corresponding to RAS guanyl releasing protein 1 Sequence RKTAQDTLYVLPSPTSPCPSPVLVRKRAFVKWENKDSLIKSKEELRHLRLPTYQELEQEINTLKADNDALKIQLKYAQKKIESLQLEKSNHVLAQMEQGD Application All Prestige Antibodies Powered by Atlas -
Add to Cart The item has been addedHPA015635-100ULSigma-Aldrich
ANTI-RASGRP2 ANTIBODY PRODUCED IN RABBIT (C15-1448-400)
Price: $977.14List Price: $1,085.71Immunogen RAS guanyl releasing protein 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA015667-100ULSigma-Aldrich
Anti-RASGRP2 antibody produced in rabbit (C15-1448-418)
Price: $879.43List Price: $977.14Immunogen RAS guanyl-releasing protein 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA058937-100ULImmunogen RAS guanyl releasing protein 3 (calcium and DAG-regulated) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most
