-
HPA000763-100UL
Sigma-Aldrich
Anti-RDX antibody produced in rabbit (C15-1445-045)
Price: $879.43List Price: $977.14Immunogen Radixin recombinant protein epitope signature tag (PrEST) Sequence AAEEAKSAIAKQAADQMKNQEQLAAELAEFTAKIALLEEAKKKKEEEATEWQHKAFAAQEDLEKTKEELKTVMSAPPPPPPPPVIPPTENEHDEHDENNAEASAELSNEGVMNHRSE Application All Prestige Antibodies Powered by Atlas -
HPA003895-100UL
Sigma-Aldrich
Anti-REEP5 antibody produced in rabbit (C15-1446-088)
Price: $879.43List Price: $977.14Immunogen Receptor expression-enhancing protein 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA069960-100UL
Sigma-Aldrich
Anti-REEP5 antibody produced in rabbit (C15-1465-782)
Price: $928.29List Price: $1,031.43Immunogen receptor accessory protein 5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA045549-100UL
Sigma-Aldrich
Anti-REG1A antibody produced in rabbit (C15-1458-559)
Price: $928.29List Price: $1,031.43Immunogen regenerating islet-derived 1 alpha recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA045579-100UL
Sigma-Aldrich
Anti-REG1A antibody produced in rabbit (C15-1458-568)
Price: $928.29List Price: $1,031.43Immunogen regenerating islet-derived 1 alpha recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA047894-100UL
Sigma-Aldrich
Anti-REG3A antibody produced in rabbit (C15-1459-380)
Price: $928.29List Price: $1,031.43Immunogen regenerating islet-derived 3 alpha Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA048334-100UL
Sigma-Aldrich
Anti-REG3A antibody produced in rabbit (C15-1459-544)
Price: $928.29List Price: $1,031.43Immunogen regenerating islet-derived 3 alpha Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA060705-100UL
Sigma-Aldrich
Anti-REG3A antibody produced in rabbit (C15-1463-606)
Price: $928.29List Price: $1,031.43Immunogen regenerating islet-derived 3 alpha Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA063461-100ULImmunogen v-rel avian reticuloendotheliosis viral oncogene homolog A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most
-
HPA040506-100ULImmunogen v-rel avian reticuloendotheliosis viral oncogene homolog B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most
-
HPA013377-100ULImmunogen RELT-like protein 1 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
-
HPA077891-100ULImmunogen reelin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human