Rabbit Serum

Immunogen ral guanine nucleotide dissociation stimulator-like 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project

Immunogen Synthetic peptide directed towards the N terminal region of human RGS18 Biochem/physiol Actions RGS18 is a member of the regulator of G-protein signaling family. This protein is contains a conserved, 120 amino acid motif called the RGS

Immunogen Recombinant protein corresponding to regulator of G-protein signaling 18. Sequence FHTKEVITNSITQPTLHSFDAAQSRVYQLMEQDSYTRFLKSDIYLDLMEGRPQRPTNLRRRSRSFTCNEFQDVQSDVAIW Application All Prestige Antibodies Powered by Atlas Antibodies are

Immunogen regulator of G-protein signaling 18 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen rhomboid, veinlet-like 2 (Drosophila) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen rhomboid, veinlet-like 3 (Drosophila) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Synthetic peptide directed towards the N terminal region of human RHOD Biochem/physiol Actions Ras homolog, or Rho, proteins interact with protein kinases and may serve as targets for activated GTPase. They play a critical role in muscle

Immunogen Synthetic peptide directed towards the C terminal region of human RHOD Biochem/physiol Actions Ras homolog, or Rho, proteins interact with protein kinases and may serve as targets for activated GTPase. They play a critical role in muscle

Immunogen Rhox homeobox family, member 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

RNF180 (Ring finger protein 180) is an integral membrane protein consisting of a RING finger (cysteine/histidine rich (C3HC4) domain for binding E2 enzymes, a basic coiled-coil domain, a novel conserved domain (DSPRC) and a hydrophobic

Immunogen ring finger protein 181 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen ring finger protein 181 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the