-
HPA012309-100ULImmunogen RING finger protein 182 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported
-
HPA057675-100ULImmunogen ring finger protein 183 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
-
HPA034547-100UL
Sigma-Aldrich
Anti-RNF186 antibody produced in rabbit (C15-1453-452)
Price: $889.20List Price: $988.00Immunogen ring finger protein 186 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA035558-100UL
Sigma-Aldrich
Anti-RNF186 antibody produced in rabbit (C15-1453-912)
Price: $928.29List Price: $1,031.43Immunogen ring finger protein 186 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA049587-100UL
Sigma-Aldrich
Anti-RNF19B antibody produced in rabbit (C15-1460-009)
Price: $928.29List Price: $1,031.43Immunogen ring finger protein 19B recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA063640-100UL
Sigma-Aldrich
ANTI-RNF19B ANTIBODY PRODUCED IN RABBIT (C15-1464-428)
Price: $977.14List Price: $1,085.71Immunogen ring finger protein 19B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA057527-100ULImmunogen ring finger protein 212 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
-
HPA003347-100UL
Sigma-Aldrich
Anti-RNF213 antibody produced in rabbit (C15-1445-906)
Price: $977.14List Price: $1,085.71Immunogen Protein ALO17 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the -
HPA026790-100UL
Sigma-Aldrich
Anti-RNF213 antibody produced in rabbit (C15-1451-204)
Price: $879.43List Price: $977.14The ring finger protein 213 (RNF213) gene is mapped around 137,922-bp region on chromosome 17q25.3. -
HPA039332-100ULImmunogen ring finger protein 214 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported
-
HPA029427-100UL
Sigma-Aldrich
Anti-RNF215 antibody produced in rabbit (C15-1452-262)
Price: $879.43List Price: $977.14Immunogen Recombinant protein corresponding to ring finger protein 215 Sequence LPLLVQFPAMGNSYGAMTCLTRWLRRGQKGLDDVSRAANCTSSCQLCKWICPSALGVWRGWENPGHLISNPVPRWVPSTPMPWGPGQWAAGGCVLGTSPMVWFGDPFQEPRRGTHRSRARISM Application All Prestige Antibodies Powered -
HPA056498-100UL
Sigma-Aldrich
Anti-RNF215 antibody produced in rabbit (C15-1462-368)
Price: $928.29List Price: $1,031.43Immunogen ring finger protein 215 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the