Rabbit Serum

Immunogen secretogranin III Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

Secretogranin-5 (SCG5) is present in cells which contain secretory granules, such as neurons and endocrine cells. The gene encoding this protein is located on chromosome 15q13-q14.

Immunogen Recombinant protein corresponding to secretogranin V Sequence AYSPRTPDRVSEADIQRLLHGVMEQLGIARPRVEYPAHQAMNLVGPQSIEGGAHE Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas

Immunogen Schwannomin interacting protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Recombinant protein corresponding to schwannomin interacting protein 1 Sequence MNLDSDGMDDIISQESSLDMEGNYKKAQKNERES Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas

Immunogen Transmembrane protein C17orf87 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

SCUBE2 (signal peptide, CUB domain, EGF-like 2) was originally recognized in endothelium and multiple nonendothelial primary cell types. In normal breasts, it is expressed in vascular endothelial and mammary ductal epithelial cells.

Immunogen signal peptide, CUB domain, EGF-like 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

SCY1-like 3 (SCYL3) is a protein involved in regulating cell adhesion and migration. It has a kinase domain and four (huntingtin elongation factor 3 (EF3), protein phosphatase 2A (PP2A) and yeast kinase TOR1) (HEAT) repeats.

Succinate dehydrogenase complex subunit D (SDHD) gene encodes for a protein SDHD. It is a small sub unit of the cytochrome b, that is involved in the complex II of mitochondrial respiration.

The gene encoding SERPINE1 mRNA binding protein 1 (SERBP1) is localized on human chromosome 1p31. Immunogen Plasminogen activator inhibitor 1 RNA-binding protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies

Immunogen secretion regulating guanine nucleotide exchange factor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project