-
Add to Cart The item has been addedAMAB91092-100ULMonoclonal Anti-LAMB1 antibody produced in mouse (C15-1318-680)
Price: $977.14List Price: $1,085.71Immunogen laminin, beta 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
Add to Cart The item has been addedAMAB91096-100ULMonoclonal Anti-LAMB2 antibody produced in mouse (C15-1318-681)
Price: $977.14List Price: $1,085.71Immunogen Recombinant protein corresponding to laminin, beta 2 (laminin S). Sequence DLTDVQDENFNANHALSGLERDRLALNLTLRQLDQHLDLLKHSNFLGAYDSIRHAHSQSAEAERRANTSALAVPSPVSNSASARHRTEALMDAQKEDFNSKHMANQRALGKLSAHTHTLSLTDINELVCGAPG Epitope Binds to an epitope -
Add to Cart The item has been addedAMAB91097-100ULMonoclonal Anti-LAMB2 antibody produced in mouse (C15-1318-682)
Price: $977.14List Price: $1,085.71Immunogen laminin, beta 2 (laminin S) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedAMAB91160-100ULMonoclonal Anti-LAMB3 antibody produced in mouse (C15-1318-711)
Price: $977.14List Price: $1,085.71Immunogen laminin, beta 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
Add to Cart The item has been addedAMAB91161-100ULMonoclonal Anti-LAMB3 antibody produced in mouse (C15-1318-712)
Price: $977.14List Price: $1,085.71Immunogen laminin, beta 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
Add to Cart The item has been added12-515Normal Sheep IgG
Price: $272.14List Price: $302.38Application Research Category Secondary & Control Antibodies Research Sub Category Whole Immunoglobulin Secondary Antibodies Quality Routinely evaluated as a negative non-specific IgG control in assays that require sheep derived antibodies. -
Add to Cart The item has been addedD411-01-1000Sheep Plasma Non-Sterile In ACD 1L
Price: $811.83List Price: $902.04pH: normal Immunoelectrophoresis: normal Hemoglobin: normal IgG Concentration: normal -
Add to Cart The item has been addedD411-05-1000Sheep Plasma Non-Sterile In K EDTA 1L
Price: $811.83List Price: $902.04pH: normal Immunoelectrophoresis: normal Hemoglobin: normal IgG Concentration: normal -
Add to Cart The item has been addedD411-04-1000Sheep Plasma Non-Sterile In Na EDTA 1L
Price: $811.83List Price: $902.04pH: normal Immunoelectrophoresis: normal Hemoglobin: normal IgG Concentration: normal -
Add to Cart The item has been addedD411-04-0050Sheep Plasma Non-Sterile In Na EDTA 50mL
Price: $329.71List Price: $366.34pH: normal Immunoelectrophoresis: normal Hemoglobin: normal IgG Concentration: normal -
Add to Cart The item has been addedD511-04-0100Sheep Plasma Sterile In Na EDTA 100mL
Price: $637.08List Price: $707.87pH: normal Immunoelectrophoresis: normal Hemoglobin: normal IgG Concentration: normal -
Add to Cart The item has been addedD511-04-0500Sheep Plasma Sterile In Na EDTA 500mL
Price: $818.02List Price: $908.91pH: normal Immunoelectrophoresis: normal Hemoglobin: normal IgG Concentration: normal
