Antibody Fragmentation Kits

Immunogen N-terminal EF-hand calcium-binding protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen N-terminal EF-hand calcium-binding protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen N-terminal EF-hand calcium binding protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Poliovirus receptor-related 1 (PVRL1), also known as nectin-1, is a member of immunoglobulin super-family. The gene coding for this protein is mapped to human chromosome 11q23.

Nuclear factor of activated T-cells, cytoplasmic 2(NFATC2) is a DNA-binding protein with a REL-homology region (RHR) and an NFAT-homology region (NHR). Upon T cell receptor (TCR) stimulation, NFATC2 gets translocated from the cytoskeleton to the

NFATC2 (nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2) is a member of the nuclear factor family called NFAT. It is expressed in peripheral T-cells, as well as cells not belonging to the immune system.

Immunogen Nuclear factor of activated T-cells, cytoplasmic 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and

Specificity Specific for the NMDAR1 C1 splice variant. AB5046P recognizes the C1 splice insert present in NR1 variants, 1a, 1b, 3a and 3b.

NME/NM23 nucleoside diphosphate kinase 1 (NME1) is an endoplasmic reticulum (ER) associated SET-complex component, which contains pp32 and Granzyme A (GzmA) substrates. The gene encoding this protein is present on chromosome 17q22.

Immunogen NME/NM23 nucleoside diphosphate kinase 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Recombinant protein corresponding to nuclear receptor subfamily 0 group B member 1 Sequence GKDHPRQGSILYSMLTSAKQTYAAPKAPEATLGPCWGCSCGSDPGVGRAGLPGGRPVALLYRCCF Application All Prestige Antibodies Powered by Atlas Antibodies are developed

Immunogen Recombinant protein corresponding to nuclear receptor subfamily 0 group B member 1 Sequence LKSPQVVCEAASAGLLKTLRFVKYLPCFQVLPLDQQLVLVRNCWASLLMLELAQDRLQFETVEVSEPSMLQKILTT Application All Prestige Antibodies Powered by Atlas Antibodies are