-
HPA001214-100UL
Anti-SNAP23 antibody produced in rabbit
Price: $879.43List Price: $977.14The SNAP23 gene maps to chromosome 15q21-22 and has eight exons. Immunogen Synaptosomal-associated protein 23 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and -
HPA001830-100UL
Anti-SNAP25 antibody produced in rabbit (C15-1445-431)
Price: $879.43List Price: $977.14Synaptosomal associated protein of 25kDa (SNAP25) is a nerve terminal protein with two isoforms, SNAP 25a and SNAP 25b. It is widely distributed in the frontal cortex and cerebellum of adult Down syndrome brain and plays an important role in Ca 2+ -
HPA071013-100UL
ANTI-SNAP25 ANTIBODY PRODUCED IN RABBIT (C15-1465-948)
Price: $977.14List Price: $1,085.71Immunogen synaptosome associated protein 25 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA031823-100UL
Anti-SNAP29 antibody produced in rabbit (C15-1453-292)
Price: $889.20List Price: $988.00Immunogen synaptosomal-associated protein, 29kDa recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA056492-100UL
Anti-SNAP29 antibody produced in rabbit (C15-1462-365)
Price: $928.29List Price: $1,031.43Immunogen synaptosomal-associated protein, 29kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA028167-100UL
Anti-SNAP47 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen synaptosomal-associated protein, 47kDa recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA029632-100UL
Anti-SNAP91 antibody produced in rabbit (C15-1452-349)
Price: $879.43List Price: $977.14Immunogen synaptosomal-associated protein, 91kDa homolog (mouse) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
HPA029633-100UL
Anti-SNAP91 antibody produced in rabbit (C15-1452-350)
Price: $879.43List Price: $977.14Immunogen synaptosomal-associated protein, 91kDa homolog (mouse) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
HPA067076-100UL
Anti-SNAPC1 antibody produced in rabbit (C15-1465-216)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to small nuclear RNA activating complex polypeptide 1 Sequence FRKLRLDRAFHFTAMPKLLSYRMKKKIHRAEVTEEFKDPSDRVMKLITSDVLEEMLNVHDHYQNMKHVISVDKSKP Application All Prestige Antibodies Powered by Atlas Antibodies -
HPA072276-100UL
Anti-SNAPC1 antibody produced in rabbit (C15-1466-192)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to small nuclear RNA activating complex polypeptide 1 Sequence TPPGLQTDCEALLSRFQETDSVRFEDFTELWRNMKFGTIFCGRMRNLEKNMFTKEALALAWR Application All Prestige Antibodies Powered by Atlas Antibodies are developed -
HPA053145-100UL
Anti-SNAPC3 antibody produced in rabbit (C15-1461-245)
Price: $928.29List Price: $1,031.43Immunogen small nuclear RNA activating complex, polypeptide 3, 50kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA066031-100UL
Anti-SNAPC3 antibody produced in rabbit (C15-1465-003)
Price: $928.29List Price: $1,031.43Immunogen small nuclear RNA activating complex, polypeptide 3, 50kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most