-
Add to Cart The item has been addedHPA045648-100ULAnti-SPATA33 antibody produced in rabbit (C15-1458-596)
Price: $928.29List Price: $1,031.43Immunogen chromosome 16 open reading frame 55 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedHPA073096-100ULAnti-SPATA33 antibody produced in rabbit (C15-1466-307)
Price: $928.29List Price: $1,031.43Immunogen spermatogenesis associated 33 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA049921-100ULAnti-SPATA45 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen spermatogenesis associated 45 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA036450-100ULAnti-SPATA5 antibody produced in rabbit (C15-1454-362)
Price: $928.29List Price: $1,031.43Immunogen spermatogenesis associated 5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA036451-100ULAnti-SPATA5 antibody produced in rabbit (C15-1454-363)
Price: $928.29List Price: $1,031.43Immunogen spermatogenesis associated 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA039585-100ULAnti-SPATA6L antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Uncharacterized protein C9orf68 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA019165-100ULAnti-SPATC1L antibody produced in rabbit (C15-1449-241)
Price: $879.43List Price: $977.14The gene SPATC1L (spermatogenesis and centriole-associated protein 1-like protein) is mapped to human chromosome 21q22.3. -
Add to Cart The item has been addedHPA029394-100ULAnti-SPATC1L antibody produced in rabbit (C15-1452-242)
Price: $879.43List Price: $977.14Immunogen Uncharacterized protein C21orf56 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA039789-100ULAnti-SSSCA1 antibody produced in rabbit (C15-1455-902)
Price: $928.29List Price: $1,031.43Immunogen Sjogren syndrome/scleroderma autoantigen 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA064670-100ULAnti-SSSCA1 antibody produced in rabbit (C15-1464-688)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to Sjogren syndrome/scleroderma autoantigen 1 Sequence VMACTQTALLQKLTWASAELGSSTSLETSIQLCGLIRACAEALRSLQQLQH Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by -
Add to Cart The item has been addedHPA046224-100ULAnti-SYT13 antibody produced in rabbit (C15-1458-781)
Price: $928.29List Price: $1,031.43Immunogen synaptotagmin XIII recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
Add to Cart The item has been addedHPA056602-100ULAnti-SYT13 antibody produced in rabbit (C15-1462-397)
Price: $928.29List Price: $1,031.43Immunogen synaptotagmin XIII Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
