-
Add to Cart The item has been addedHPA015984-100ULAnti-TMEM132C antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Transmembrane protein 132C precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedHPA044562-100ULAnti-TMEM161B antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen transmembrane protein 161B recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedABN471Anti-TMEM18 Antibody (C15-1317-608)
Price: $672.00List Price: $746.67Transmembrane protein 18 (TMEM18) is a transcription repressor and cell migration modulator which enhances the glioma-specific migration ability of neural stem cells (NSC) and neural precursor cells (NPC). Recent studies have shown that -
Add to Cart The item has been addedHPA016830-100ULAnti-TMEM19 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Transmembrane protein 19 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedHPA014717-100ULAnti-TMEM192 antibody produced in rabbit (C15-1448-218)
Price: $879.43List Price: $977.14TMEM192 (transmembrane protein 192) is a membrane protein that localizes to lysosomes. It has a predominant expression in lung, liver, pancreas and kidney. -
Add to Cart The item has been addedHPA024110-100ULAnti-TMEM192 antibody produced in rabbit (C15-1450-634)
Price: $879.43List Price: $977.14Immunogen Transmembrane protein 192 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA043163-100ULAnti-TMEM196 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen transmembrane protein 196 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA066784-100ULAnti-TMEM211 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen transmembrane protein 211 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA045736-100ULAnti-TMEM212 antibody produced in rabbit
Price: $977.14List Price: $1,085.71Immunogen transmembrane protein 212 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA054059-100ULAnti-TMEM213 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen transmembrane protein 213 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA052804-100ULAnti-TMEM215 antibody produced in rabbit (C15-1461-147)
Price: $928.29List Price: $1,031.43Immunogen transmembrane protein 215 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA063207-100ULAnti-TMEM215 antibody produced in rabbit (C15-1464-306)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to transmembrane protein 215 Sequence TEGCTKWPENELLWVRKLPCFRKPKDKEVVELLRTPSDLESGKGSSDELAKKAGLRGKPPPQSQGE Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the
