-
HPA048471-100UL
Anti-COL27A1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen collagen, type XXVII, alpha 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA043844-100UL
Anti-COL28A1 antibody produced in rabbit (C15-1457-901)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to collagen type XXVIII alpha 1 chain Sequence SESLSVTRDQDEDDKAPEPTWADDLPATTSSEATTTPRPLLSTPVDGAEDPRCLEALKPGNCGEYVVRWYYDKQVNSCARFWFSGCNGSGNRFNSEKECQET Application All Prestige Antibodies Powered by Atlas -
HPA060468-100UL
Anti-COL28A1 antibody produced in rabbit (C15-1463-546)
Price: $928.29List Price: $1,031.43Immunogen collagen, type XXVIII, alpha 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
HPA056390-100UL
Anti-CREG1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen cellular repressor of E1A-stimulated genes 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA000556-100UL
Anti-CRIM1 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Cysteine-rich motor neuron 1 protein precursor recombinant protein epitope signature tag (PrEST) Features and Benefits Prestige Antibodies ® are highly characterized and extensively validated antibodies with the added benefit of all -
HPA022035-100UL
Anti-CRTC1 antibody produced in rabbit (C15-1450-065)
Price: $879.43List Price: $977.14Immunogen CREB-regulated transcription coactivator 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA063619-100UL
ANTI-CRTC1 ANTIBODY PRODUCED IN RABBIT (C15-1464-419)
Price: $977.14List Price: $1,085.71Immunogen CREB regulated transcription coactivator 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA042483-100UL
Anti-CT47A1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen cancer/testis antigen family 47, member A1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA064369-100UL
Anti-CUTA antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen cutA divalent cation tolerance homolog (E. coli) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA038619-100UL
Anti-CUTC antibody produced in rabbit (C15-1455-351)
Price: $928.29List Price: $1,031.43Immunogen cutC copper transporter homolog (E. coli) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA058231-100UL
ANTI-CUTC ANTIBODY PRODUCED IN RABBIT (C15-1462-872)
Price: $977.14List Price: $1,085.71Immunogen cutC copper transporter Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA031991-100UL
Anti-CXCR1 antibody produced in rabbit
Price: $889.20List Price: $988.00Immunogen chemokine (C-X-C motif) receptor 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization