-
HPA053691-100UL
Anti-TRIM55 antibody produced in rabbit (C15-1461-420)
Price: $928.29List Price: $1,031.43Immunogen tripartite motif containing 55 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
HPA024358-100UL
Anti-TRIM56 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Tripartite motif-containing protein 56 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA023637-100UL
Anti-TRIM58 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Tripartite motif-containing protein 58 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
AV43451-100UL
Anti-TRIM59 (AB2) antibody produced in rabbit
Price: $759.43List Price: $843.81Immunogen Synthetic peptide directed towards the middle region of human TRIM59 Sequence Synthetic peptide located within the following region: LEKVDDVRQHVQILKQRPLPEVQPVEIYPRVSKILKEEWSRTEIGQIKNV Physical form Purified antibody supplied in 1x PBS -
HPA060514-100UL
Anti-TRIM6 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen tripartite motif containing 6 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
HPA035809-100UL
Anti-TRIM60 antibody produced in rabbit (C15-1454-018)
Price: $928.29List Price: $1,031.43Immunogen tripartite motif containing 60 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
HPA035810-100UL
Anti-TRIM60 antibody produced in rabbit (C15-1454-019)
Price: $928.29List Price: $1,031.43Immunogen tripartite motif-containing 60 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA061496-100UL
Anti-TRIM60 antibody produced in rabbit (C15-1463-824)
Price: $928.29List Price: $1,031.43Immunogen tripartite motif containing 60 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
HPA049109-100UL
Anti-TRIM61 antibody produced in rabbit
Price: $928.29List Price: $1,031.43In mice, TRIM61 (tripartite motif containing 61) is an oocyte mRNA and might be involved in protein modifications. It is located on chromosome 4q32. -
HPA050061-100UL
Anti-TRIM62 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen tripartite motif containing 62 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
HPA045370-100UL
Anti-TRIM64 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen tripartite motif containing 64 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
HPA021575-100UL
Anti-TRIM65 antibody produced in rabbit (C15-1449-924)
Price: $879.43List Price: $977.14Immunogen Tripartite motif-containing protein 65 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,