Antibody Fragmentation Kits

Monoclonal anti-Heat Shock Protein 25 (mouse IgG1) isotype) is derived from the IAP-28 hybridoma produced by the fusion of mouse myeloma cells and splenocytes from BALB/c mice immunized with partially purified inhibitor of actin polymerization

Monoclonal Anti-Heat Shock Protein 60 (HSP60), clone LK2, recognizes an epitope located between amino acid residues 383-419 of the human (corresponding to a.a.

Heat shock (stress) proteins (HSP) are produced by prokaryotic and eukaryotic cells, and are among the most conserved molecules in phylogeny. HSP-60 is a member of HSP family with a uniquely high level of sequence conservation.

A variety of environmental disruptions, such as a sudden increase in temperature, induce cells to rapidly synthesize a group of polypeptides known as heat shock (stress) proteins. Eukaryotic cells contain a multigene family that encodes several

A variety of environmental disruptions, such as a sudden increase in temperature, induce cells to rapidly synthesize a group of polypeptides known as heat shock (stress) proteins. Eukaryotic cells contain a multigene family that encodes several

HSP90AB1 (heat shock protein 90&#945 family class B member 1) belongs to the Hsp90 family. It consists of major members-Hsp90&#945, Hsp90&#946, GRP94 (glucose-regulated protein 94) and Hsp75.

HSP90AB1 (heat shock protein 90&#945 family class B member 1) belongs to the Hsp90 family. It consists of major members-Hsp90&#945, Hsp90&#946, GRP94 (glucose-regulated protein 94) and Hsp75.

Immunogen ras homolog family member T1, recombinant protein epitope signature tag (PrEST) Sequence THIVDYSEAEQSDEQLHQEISQANVICIVYAVNNKHSIDKVTSRWIPLINERTDKDSRLPLILVGNKSDLVEYSSMETILPIMNQYTEIE Epitope Binds to an epitope located within the peptide

Miro1/RHOT1 (ras homolog family member T1) is an outer mitochondrial membrane (OMM) protein. It has a transmembrane domain, two GTPase domains and two Ca 2+ -sensing EF-hand domains.

Purified mouse monoclonal antibody. Recognizes human IgG 4 Fc fragment.

Anti-NMDA R2B (Rabbit) antibody is suitable for use in Western Blotting and IHC. Specific conditions for reactivity should be optimized by the end user.

This antibody diluent is compatible with common stabilizing compounds at pH 7.3. Contains phosphate buffered saline. The buffer is filtered through a 0.2 um filter. Ready-to-use sterile phosphate buffered saline.